Details for Kale Locus Bo8g090620

Position : C8 ( 5`- 30441593 .. 30443589 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090620

Protein [Map View]
MSPPIKSPLLPKQEPSSEKHGSTSGVVFNVSTSIIGAGIMSMPAAFKVLGVVPALLIITIIAWLSTISVGFLMKSTLAGE
ATTYAGVMKESFGKAGSVAVQVATMVATFGCMVIFSIIIGDVLSGNDNGGSVHLGVLQEWFGSHWWNTRIFSLLFIYAFV
LLPLVLCRRVERLAFSSAISFLLAVLFVVISSVLAISALMEGQTKNPRLFPDLTNGGSFWNLFTASPVIVTAFTFHFNVH
PIGFELKDPLHVIPATKISVILCAAIYFATGLFGYLLFGDATMSDILVNFDESSGSSIGSLLNDIVRLSYALHLMLVFPL
MNFSLRANLDELMFPTMKAPLAKDTKRFVGLTLALLICCFLSAIAVPDIWYFFQFLGSTTTVSIAFIFPAAIVLRNVNGV
STSREKIVAAIMLVLAVATSIVAISTNLYSLTSK*

DNA
ATGTCTCCTCCGATCAAAAGTCCTCTCTTGCCAAAGCAAGAACCGTCTTCTGAGAAACATGGATCTACCTCCGGCGTCGT
TTTCAACGTGTCGACGAGTATAATCGGAGCCGGTATAATGTCGATGCCGGCGGCGTTTAAAGTTCTCGGAGTTGTCCCAG
CTCTTTTGATCATCACGATCATCGCTTGGCTATCCACAATATCTGTTGGCTTTCTTATGAAATCAACTCTCGCCGGAGAA
GCGACCACGTACGCCGGAGTTATGAAAGAGTCGTTCGGTAAAGCAGGTTCCGTGGCTGTACAGGTTGCTACAATGGTTGC
TACTTTTGGATGCATGGTTATCTTCTCGATCATTATAGGAGATGTGCTCTCCGGTAATGACAATGGAGGATCTGTTCATC
TTGGAGTTTTGCAAGAATGGTTTGGTTCTCACTGGTGGAACACGAGGATCTTCTCTTTGTTGTTTATCTACGCCTTCGTC
TTGCTTCCATTAGTCTTGTGCAGACGTGTAGAAAGACTTGCGTTTAGTTCTGCCATATCGTTTCTTCTTGCTGTGCTCTT
TGTCGTCATAAGCTCGGTGCTAGCGATCTCCGCGTTGATGGAAGGCCAAACGAAGAACCCGAGACTTTTTCCGGATTTAA
CCAATGGAGGATCGTTCTGGAATCTCTTCACAGCTTCTCCTGTTATAGTAACAGCCTTCACGTTTCATTTCAATGTTCAT
CCAATTGGATTCGAGCTCAAGGATCCTTTACATGTGATCCCAGCAACTAAGATCTCTGTGATCTTGTGCGCTGCAATATA
CTTCGCCACTGGGCTCTTTGGATATCTCCTGTTTGGAGATGCAACAATGTCTGATATTCTAGTGAACTTTGACGAGAGTT
CAGGCTCTTCCATTGGTTCTCTTCTCAATGACATCGTCAGGCTCAGCTACGCACTTCACCTCATGCTCGTCTTTCCTCTC
ATGAACTTCTCACTGAGAGCTAACCTCGACGAGCTCATGTTCCCAACAATGAAGGCTCCATTGGCAAAAGACACAAAAAG
ATTTGTTGGACTAACTCTAGCTTTACTGATCTGCTGTTTCTTGTCTGCTATCGCTGTGCCGGACATTTGGTACTTCTTTC
AGTTCTTGGGATCAACCACCACAGTTTCCATAGCGTTCATATTTCCAGCCGCCATTGTCTTAAGGAATGTCAATGGTGTA
TCGACCTCAAGGGAGAAGATTGTAGCTGCGATTATGCTGGTTCTTGCTGTTGCCACTAGCATCGTCGCCATCTCGACGAA
TTTATACAGTCTCACATCAAAATGA