Details for Kale Locus Bo8g090610

Position : C8 ( 5`- 30438116 .. 30440310 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090610

Protein [Map View]
ILPPDRFLLPHLQRSKPSRGRKGNENNRKHTIGVDLKSESREVMGDHLVRAEEFEKKAEKKLNGWGIFGSKHEDAADLLE
KAANSYKLAKSWDLAGKAYLKVADCHLKSDSKHDAANAYAEAAKCYKKVDTNEAASCLERAVNIFCEIGRLNMAARYYKE
IAEYYEADQKIEQAIDYFEKAAEFFQNEEVTTSANQCNLKVAQYASQLEQYEKAIKIYEEIARHSLGNNLLKYGVKGHLL
NAGLCHLCKADVVSITNALEKYQDLDPTFTGTRECKFLSDLASAIDEEDIAKFTDVVKEFDSMTPLDSWKTTMLLRVKEK
LKAKELEEDDLT*

DNA
ATTCTTCCTCCCGATCGATTTCTCCTCCCTCATTTGCAACGAAGCAAACCCTCTCGAGGAAGAAAAGGAAACGAGAACAA
TAGAAAGCATACGATCGGAGTCGATTTGAAGTCAGAGTCTAGGGAAGTTATGGGGGATCATCTGGTGAGAGCGGAGGAAT
TTGAGAAGAAGGCAGAGAAGAAGCTCAACGGATGGGGAATATTCGGATCTAAGCACGAGGATGCTGCCGATCTCCTCGAG
AAAGCTGCTAATTCCTATAAGCTCGCCAAATCATGGGATCTAGCTGGAAAGGCTTATCTTAAAGTTGCAGACTGTCACTT
GAAGTCTGACAGCAAACATGATGCTGCTAATGCTTATGCCGAAGCTGCTAAATGCTACAAGAAAGTTGACACTAATGAGG
CTGCATCTTGTCTAGAGCGAGCTGTGAATATTTTCTGCGAGATAGGGAGGCTCAACATGGCTGCCAGATACTACAAGGAA
ATTGCTGAGTATTATGAAGCAGACCAGAAGATAGAGCAGGCTATTGATTACTTTGAAAAGGCAGCTGAGTTCTTTCAAAA
TGAAGAAGTGACCACTTCTGCAAACCAGTGCAATCTAAAGGTGGCACAATATGCTTCCCAGTTGGAGCAATATGAGAAGG
CAATCAAGATTTATGAAGAAATTGCACGCCATTCACTCGGCAATAACTTGCTTAAGTATGGAGTTAAGGGCCATCTTCTC
AATGCTGGCTTGTGCCACCTCTGCAAAGCTGATGTTGTTTCCATCACCAACGCTCTGGAGAAATATCAGGATCTGGATCC
AACTTTTACTGGAACACGAGAATGCAAATTCTTATCTGATCTTGCTTCTGCTATCGATGAAGAAGACATCGCAAAGTTCA
CAGACGTTGTCAAGGAATTTGATAGCATGACTCCGCTGGATTCATGGAAGACAACAATGTTGTTGAGGGTGAAGGAGAAG
CTGAAGGCAAAGGAGCTTGAAGAGGATGATCTTACCTAA