Details for Kale Locus Bo6g119370

Position : C6 ( 5`- 37348960 .. 37351719 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119370

Protein [Map View]
MSDTEEARNDLRRPFIHTGSWYRMGSRQSSMMGSSQVIRDSSISVLACVLIVALGPIQFGFTCGYSSPTQAAITKDLGLT
VSEYSVFGSLSNVGAMVGAIASGQIAEYIGRKGSLMIAAIPNIIGWLCISFAKDTSFLYMGRLLEGFGVGIISYTVPVYI
AEIAPQNMRGGLGSVNQLSVTIGIMLAYLLGLFVPWRILAVLGTLPCIVLIPGLFFIPESPRWLAKMGMTDDFETSLQVL
RGFETDITVEVNEIKRSVASSTKRSSTVRFVDLKRRRYYFPLMVGIGLLVLQQLGGINGVLFYSSTIFESAGVTSSNAAT
FGVGAIQVVATAISTWLVDKAGRRLLLTISSVGMTISLVIVAAAFYLKGFVSHDSDMYSMLSILSVVGVVAMVVSFSLGM
GPIPWLIMSEILPVNIKGLAGSIATLANWFFSWLITMTANLLLAWSSGGTFTLYAVVCAFTVVFVTLWVPETKGKTLEEL
QALFR*

DNA
ATGAGTGATACAGAGGAGGCGAGGAATGATCTGCGACGACCTTTCATACACACGGGAAGCTGGTACCGGATGGGCTCAAG
ACAATCGAGCATGATGGGTTCGTCTCAAGTCATCAGAGACAGCTCAATCTCTGTTCTTGCTTGTGTCCTGATCGTTGCTC
TTGGCCCTATTCAATTCGGTTTCACTTGTGGTTATTCTTCTCCGACACAAGCTGCAATCACTAAAGATCTCGGTTTAACT
GTATCTGAGTACTCTGTGTTTGGTTCTCTATCCAATGTGGGAGCTATGGTTGGTGCAATTGCCAGTGGTCAGATTGCAGA
ATACATTGGAAGAAAAGGGTCTCTGATGATTGCTGCAATTCCCAATATCATTGGCTGGCTTTGCATATCATTTGCTAAAG
ATACTTCTTTTCTTTACATGGGAAGGCTTTTAGAAGGCTTTGGTGTTGGGATCATCTCTTACACGGTGCCTGTGTATATC
GCTGAGATAGCTCCACAGAATATGAGGGGAGGACTAGGTTCAGTGAACCAGCTTTCTGTGACAATTGGAATAATGCTGGC
TTATTTACTTGGCCTCTTTGTGCCATGGAGGATTCTTGCGGTTTTGGGGACATTGCCATGCATAGTATTGATACCGGGAC
TCTTCTTCATTCCTGAATCCCCTCGCTGGCTTGCGAAAATGGGTATGACTGATGATTTTGAAACTTCATTACAAGTTCTC
AGAGGGTTTGAGACTGATATCACCGTTGAGGTTAATGAGATCAAGAGATCAGTGGCGTCATCTACAAAGAGATCATCTAC
AGTTCGGTTTGTTGATCTCAAGCGGAGGAGATACTATTTCCCACTTATGGTTGGTATAGGGTTGCTTGTACTTCAACAAC
TCGGTGGGATCAATGGCGTTTTATTCTATTCCAGTACAATCTTTGAATCTGCAGGAGTTACATCAAGTAATGCAGCAACA
TTTGGGGTCGGTGCTATTCAAGTAGTGGCGACTGCAATATCAACATGGTTGGTGGACAAAGCAGGTCGTCGGCTTCTGCT
TACCATCTCGTCGGTTGGGATGACGATCAGTTTAGTAATCGTTGCAGCTGCTTTCTACCTTAAGGGATTTGTGTCTCATG
ATTCAGACATGTACAGTATGCTGAGCATCTTGTCAGTAGTTGGAGTAGTGGCAATGGTTGTTTCTTTCTCGTTAGGAATG
GGACCAATTCCATGGCTCATTATGTCTGAGATCCTTCCTGTGAACATAAAGGGTTTAGCTGGAAGTATAGCCACTTTAGC
AAATTGGTTCTTCTCTTGGTTGATCACCATGACTGCAAACTTGCTCTTAGCCTGGAGCAGTGGAGGAACTTTCACTCTAT
ACGCTGTGGTTTGTGCATTCACAGTGGTGTTTGTAACTCTATGGGTTCCTGAGACCAAAGGGAAAACGCTTGAAGAACTT
CAAGCCTTGTTCAGATGA