Details for Kale Locus Bo6g119360

Position : C6 ( 5`- 37344367 .. 37348258 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119360

Protein [Map View]
MLLNKRHFSLCVSLFLPCAQRQLLNSSAGTSRICFKSSMEEQRASGLTDRVVQFQNVGSRDGCEAPHKWSSSGGGKKIDV
RNQIFCNRSLNMKNIIAVGFDMDYTLAQYKSETFESLAYEGTVRKLVYDLGYPRELLEWTFDWNYMVRGLVLDKKKGNIL
KMDRHKYVKVAYHGFKELSKEEKVDVYGTSLVRDSFDEPDYALIDTLFSLAEAYLFAQLVDFKDNNPDKILKDVDYGRMY
KDVRSAVDMCHRDGTLKQMVAKEPNKYINEDATIVPLIKMIRDSGRSTFLVTNSLWDYTNIVMNFLCGGRTVHGPDPCNF
DWLQYFDVVITGSAKPGFFHEESRVNLFEVELKSGMLINTDNGTPMAQIGDPSPKIPMKSKDKACRVFQGGNVGHLHSLL
SIQSSSQVLYVGDHIYGDILRSKKVLGWRTMLVVPELEKEVELLWELRDARKEQILMRNERDSVEDKIHRLSWSLKFEDI
NEKDKQEMLSAVKDLVCKRDEVRLNLQEAQRDSHKKFHKVWGQLMKTGYQSSRFAHQVERFACLYTSQVSNLRLYSPEKY
YKPSEDFMSHEFHLLPL*

DNA
ATGCTTCTCAACAAGCGTCATTTCTCTCTCTGTGTCTCTCTGTTCCTTCCTTGTGCACAAAGACAGTTACTCAATTCTTC
TGCTGGGACAAGTCGTATCTGTTTCAAGAGTTCAATGGAAGAACAAAGAGCTAGTGGTCTTACGGACAGGGTGGTGCAGT
TTCAAAATGTGGGATCAAGGGACGGATGTGAAGCTCCCCATAAGTGGTCATCCTCTGGAGGAGGAAAGAAAATCGACGTA
AGAAACCAGATCTTCTGCAATAGATCTTTGAACATGAAGAATATCATTGCCGTAGGCTTTGATATGGACTATACTCTGGC
CCAGTATAAGTCTGAAACTTTTGAGTCCCTAGCGTATGAAGGCACTGTGAGGAAGTTGGTATACGATTTAGGGTATCCAA
GAGAGCTGCTGGAATGGACATTTGATTGGAACTATATGGTTAGAGGGTTGGTTCTAGACAAAAAGAAAGGAAACATCTTA
AAGATGGATCGCCATAAGTATGTGAAGGTGGCTTACCATGGGTTTAAGGAGCTCTCTAAGGAGGAAAAAGTTGATGTCTA
TGGGACTAGCCTAGTACGAGATTCTTTTGATGAGCCTGACTACGCTCTCATTGATACTCTCTTCTCTTTGGCCGAAGCCT
ATCTCTTTGCCCAACTCGTTGACTTCAAAGATAACAACCCTGATAAAATCCTCAAGGACGTTGATTATGGTCGCATGTAT
AAAGATGTCCGGTCTGCTGTTGATATGTGCCACCGTGATGGAACTTTGAAGCAGATGGTGGCAAAGGAACCAAATAAGTA
TATCAACGAGGATGCTACCATTGTACCTCTGATAAAAATGATAAGAGATTCCGGACGCTCAACATTCTTGGTGACCAATA
GTTTGTGGGACTACACAAATATTGTGATGAACTTTCTCTGTGGAGGCCGCACTGTACATGGTCCTGATCCTTGCAACTTT
GATTGGCTCCAGTACTTTGATGTTGTGATCACTGGCAGTGCAAAACCTGGTTTCTTCCATGAGGAGAGTCGTGTCAACCT
TTTTGAGGTGGAACTTAAGTCAGGGATGCTGATCAATACTGACAATGGAACACCTATGGCTCAGATTGGAGATCCTTCGC
CAAAAATTCCAATGAAGAGTAAAGACAAAGCGTGTCGAGTTTTCCAAGGTGGGAATGTTGGTCATCTTCACAGTCTGCTC
TCCATCCAGTCAAGTTCACAGGTCCTTTACGTTGGCGATCACATATACGGTGACATCTTGCGCAGCAAAAAAGTACTCGG
GTGGAGGACGATGCTTGTTGTTCCGGAACTTGAAAAGGAGGTTGAACTTCTGTGGGAGCTTAGGGACGCGCGTAAGGAAC
AAATTTTGATGAGGAATGAGCGTGACTCAGTGGAAGATAAGATCCATCGCTTAAGCTGGTCTTTGAAGTTTGAAGATATC
AACGAGAAAGACAAGCAGGAAATGCTATCAGCGGTTAAGGACTTAGTGTGTAAAAGGGATGAAGTCCGACTAAATCTTCA
AGAAGCTCAAAGAGACAGTCACAAAAAGTTTCATAAGGTCTGGGGGCAATTAATGAAAACTGGTTACCAGAGTTCTAGAT
TTGCTCACCAGGTGGAGAGATTTGCATGCCTGTACACGAGCCAAGTATCTAACTTGCGCTTGTACTCCCCAGAAAAGTAC
TACAAACCAAGTGAGGACTTCATGTCCCATGAGTTCCACCTTCTCCCCCTTTGA