Details for Kale Locus Bo6g119350

Position : C6 ( 5`- 37340879 .. 37343634 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119350

Protein [Map View]
MASSSSIHARLALVALLSATTLYCIHKYRRLKRLKTLSLNPSTRRGKIFFISETGTSKSLAQRLHKLLESNGVAFDLVDP
TSYEPEDLPKETLAIFVASTWDGGKPPKDGEFLVDWLSESAEDFRVGSLLLSGCRFGVFGVGSRAYGEEYNAVAKEMSRR
MVGLGGAEMVPLGEGDVDDGELDRAFQGWCDGVIRVLKGGSAQAQETNEITQNGVVESEDEYIDTTDEEEEDDNNDIVDL
EDIAGKAPSMKNGVVKVAKRGDGKKEMVTPVIRASLTKQGYKIIGSHSGVKICRWTKSQLRGRGGCYKHSFYGIESHRCM
ETTPSLACANKCVFCWRHHTNPVGKSWQWKMDDPKEIVKGALDLHTKMIKQMKGVPGVTPEKLQEGLTPRHCALSLVGEP
IMYPEINALVDELHGKRISTFLVTNAQFPEKILMMKPITQLYVSVDAATKESLKAIDRPLFADFWERFIDSLKALQEKQQ
RTVYRLTLVKGWNTEELEAYFNLFSIGKPDFIEIKGVTYCGSSATSKLTMENVPWHADVKAFSEALSVKSNGEYEVACEH
AHSCCVLLGRTDKFKVDGKWFTWIDYEKFHDLVASGEPFTSRDYMAETPSWAVYGAEEGGFDPEQLRYKKERHHHPKPQA
IVA*

DNA
ATGGCTTCGTCGTCCTCCATTCACGCTCGACTAGCTCTCGTAGCTCTTCTCTCCGCGACTACTCTCTACTGCATCCACAA
ATACCGCCGCCTGAAACGTCTCAAAACCCTCTCCTTAAACCCTAGCACGAGAAGGGGAAAGATCTTCTTCATCTCCGAAA
CGGGAACATCCAAATCCCTAGCTCAGCGCCTCCACAAGCTCCTGGAATCGAACGGCGTCGCGTTCGATCTCGTCGATCCA
ACTAGCTACGAGCCGGAGGATCTCCCCAAGGAGACGCTGGCCATCTTCGTCGCGTCGACGTGGGACGGAGGGAAGCCGCC
CAAGGACGGGGAGTTTCTCGTCGACTGGCTATCGGAGAGCGCGGAGGATTTTCGAGTCGGATCGCTTCTTCTCTCCGGTT
GCAGATTCGGAGTCTTCGGCGTCGGGAGCCGCGCTTACGGCGAGGAGTACAACGCGGTGGCGAAGGAGATGTCGAGGAGG
ATGGTGGGGTTGGGGGGAGCGGAGATGGTTCCGTTGGGAGAAGGTGACGTGGACGATGGAGAGTTAGATAGAGCGTTTCA
GGGGTGGTGTGATGGAGTGATTAGAGTTCTGAAGGGAGGCTCTGCTCAGGCTCAAGAAACTAATGAGATTACTCAAAACG
GTGTCGTTGAGAGTGAAGACGAATACATTGATACAACAGATGAAGAGGAGGAAGATGATAATAATGATATTGTTGATCTT
GAAGATATTGCTGGAAAAGCTCCTTCTATGAAGAATGGTGTTGTTAAAGTTGCGAAACGTGGTGATGGGAAGAAGGAGAT
GGTGACTCCTGTGATTAGAGCTAGCCTAACGAAACAGGGGTATAAGATCATTGGCTCGCATAGTGGGGTTAAGATTTGTA
GATGGACGAAGTCACAGCTTAGAGGCAGGGGAGGTTGTTACAAGCACTCCTTTTATGGCATTGAGAGTCACAGGTGTATG
GAGACAACACCTAGTTTAGCTTGTGCGAACAAATGTGTCTTCTGTTGGAGGCATCACACAAATCCCGTGGGGAAGAGCTG
GCAGTGGAAGATGGACGATCCTAAAGAGATTGTGAAAGGTGCTCTTGATCTTCATACAAAGATGATTAAACAGATGAAAG
GAGTTCCAGGTGTAACTCCAGAGAAGTTACAAGAAGGCCTAACGCCAAGGCATTGTGCGTTATCACTTGTTGGTGAGCCA
ATTATGTATCCAGAGATCAATGCCCTTGTGGATGAGCTTCATGGAAAGCGTATTTCCACATTCTTGGTTACTAATGCACA
ATTCCCCGAAAAGATCTTGATGATGAAGCCTATCACCCAGTTGTACGTAAGTGTAGATGCTGCCACCAAAGAGAGCTTGA
AGGCTATTGATAGGCCTCTCTTTGCAGACTTCTGGGAGCGGTTTATTGACTCCTTGAAAGCTCTCCAAGAGAAGCAGCAA
CGAACAGTCTATCGTTTAACACTTGTCAAAGGATGGAACACAGAAGAGCTAGAAGCTTATTTCAATCTCTTCAGCATTGG
GAAACCTGACTTCATCGAGATCAAAGGGGTCACATATTGTGGATCATCTGCAACATCAAAGTTGACAATGGAGAACGTAC
CGTGGCACGCTGACGTTAAAGCATTCTCAGAAGCTCTGTCTGTGAAGAGCAATGGAGAGTACGAGGTTGCTTGCGAGCAC
GCCCATTCTTGCTGTGTTCTTCTAGGGAGAACTGACAAGTTCAAGGTGGATGGAAAGTGGTTCACCTGGATCGACTATGA
GAAGTTCCATGATCTGGTTGCGTCTGGAGAACCATTCACGAGCAGGGACTATATGGCTGAAACACCATCATGGGCAGTTT
ATGGAGCAGAGGAAGGTGGGTTTGATCCAGAGCAGTTGCGTTACAAGAAGGAAAGGCATCATCACCCTAAACCACAAGCT
ATTGTAGCTTAA