Details for Kale Locus Bo6g119310

Position : C6 ( 5`- 37329347 .. 37330821 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119310

Protein [Map View]
MAQLYTPIWVWAAQLDIPTLTHIPLDPDSLLEINGVRCSQGVSSQLRRDRVDKRSEAVTYISTDSIRLSGSVRFEVYDRE
ELVLSGTLELSGSNNGFTGESVKHSVKRWGMSCEAEITAGCGFLKEKKHIGCSEMSSSPLLPTVEVYVTGCFSGTPIILT
KTLQLGFRKKQVNRVAALDSIPEYETGETHKGNSSELDFQVTEYGRYKQDYEGEYGDMYMGREYADVEDGEMSWFNAGVR
VGVGIGLGVCVGLGIGVGLLVRTYQSTTRNFRRRVI*

DNA
ATGGCCCAACTGTACACACCCATTTGGGTGTGGGCCGCCCAACTTGACATCCCTACCCTCACCCACATCCCTCTGGATCC
AGACTCGCTCCTCGAGATCAACGGTGTTCGATGCTCTCAAGGAGTTTCCTCTCAGCTGAGGAGAGACCGTGTTGATAAGA
GATCTGAAGCCGTTACTTACATCAGCACAGACAGCATCAGGCTATCCGGTAGCGTGAGGTTTGAGGTGTATGACAGAGAA
GAGCTGGTTTTGTCTGGGACGTTGGAGTTGTCTGGTAGTAATAATGGCTTCACAGGGGAGTCTGTTAAGCATAGCGTGAA
GCGGTGGGGGATGAGCTGTGAAGCTGAGATCACTGCAGGGTGTGGTTTCTTGAAGGAGAAGAAACACATTGGTTGTTCTG
AGATGTCATCATCTCCGTTGTTGCCGACTGTTGAAGTTTATGTCACTGGTTGCTTCTCTGGAACACCTATCATCTTGACC
AAGACGCTTCAGCTTGGTTTTAGGAAGAAGCAGGTCAATAGAGTGGCTGCGTTAGATTCGATTCCTGAGTATGAGACCGG
CGAGACTCATAAAGGCAACTCGTCTGAGCTTGATTTTCAGGTAACAGAATACGGAAGGTATAAACAAGACTATGAAGGAG
AATACGGAGACATGTATATGGGAAGAGAGTACGCAGATGTTGAAGATGGCGAAATGTCTTGGTTCAACGCTGGTGTGAGG
GTTGGTGTTGGAATTGGTCTTGGCGTCTGTGTAGGTCTCGGCATTGGTGTTGGCCTTCTGGTGCGAACCTATCAATCAAC
CACCAGAAACTTCAGAAGAAGAGTCATCTAG