Details for Kale Locus Bo6g119270

Position : C6 ( 5`- 37308610 .. 37310641 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119270

Protein [Map View]
MAVPLVFFLFLFLLIFRFVYTNLWIPWRLQSHFNRLRLTGPRYRIFTGNSSEVTRLTAEAKSKPIPSGDNNPHEFVHRVA
PHYHNWSRAYGKTFLYWFGTKPVVATSDPKLIREALKIKSFDRIGHNPLSKLLYAQGLPGLRGDQWAFHRRIAVQAFTMD
KVKRWVPQMVASTLMFLEKWEEMRNGEEEVELDVHKEIHSLSAHMLSRTAFGNNVEEGKRIFALQERMMRLFYLVRWSIY
IPGYRFLPSKTNREIWSIEKQIRGSILGLIEKNKTRDAEIAGTLLQAFMSPYVNQNGQEEKLGIEEVIDECKTFYFAAKE
TTGDLMTWVLVLLAMHQEWQSTAREEVIRVLGPNGLPTPDILQDLKTLGMIINETLRLYPPAMTLNRDTLRKAKLGSLEI
PEGTQLYLSVVAMHHDREAWGEDAEEFNPGRFEDTRKESALLVPFGLGVRTCVGQNLAVVEAKTVLATILRHYSFRLSPS
YVHAPVLFVTLQPQKGAHLLFSRI*

DNA
ATGGCAGTGCCCTTGGTCTTCTTCCTCTTTCTCTTCCTTCTCATCTTCAGATTCGTTTACACTAATCTATGGATCCCTTG
GAGGCTCCAATCTCATTTCAACAGGCTTCGCTTAACGGGACCTCGTTACCGGATATTCACCGGAAACTCGTCGGAAGTTA
CCCGTTTAACAGCCGAAGCGAAGTCAAAGCCGATACCTTCCGGAGACAACAACCCTCACGAGTTCGTACACCGTGTGGCG
CCTCACTACCACAACTGGTCACGCGCCTACGGGAAGACTTTCCTCTACTGGTTCGGTACCAAACCGGTGGTTGCCACGTC
GGATCCGAAACTAATCAGGGAAGCTTTGAAGATCAAGTCGTTTGATCGTATCGGACATAACCCTTTGTCTAAGCTTCTTT
ACGCTCAGGGTCTTCCTGGGCTTCGAGGTGATCAATGGGCTTTCCATAGAAGAATCGCTGTTCAAGCTTTCACCATGGAT
AAAGTCAAGAGGTGGGTGCCGCAAATGGTGGCAAGTACTTTGATGTTTCTGGAGAAATGGGAGGAGATGAGAAATGGAGA
AGAGGAGGTTGAGCTAGATGTACACAAAGAGATACACAGTTTGTCTGCACATATGTTATCAAGAACAGCTTTTGGTAACA
ACGTAGAAGAAGGAAAACGAATCTTTGCGTTGCAAGAGCGTATGATGCGTCTCTTCTACCTAGTCCGATGGAGCATTTAC
ATCCCCGGGTACAGATTCTTGCCTTCCAAGACTAATAGAGAGATATGGAGTATTGAGAAACAAATCCGTGGTTCTATCCT
GGGACTCATCGAGAAAAACAAGACAAGAGACGCGGAGATAGCAGGAACCCTGCTTCAGGCTTTTATGTCTCCTTACGTCA
ATCAGAATGGTCAAGAGGAGAAGCTTGGGATTGAAGAAGTTATAGATGAGTGCAAGACTTTCTACTTTGCAGCCAAAGAA
ACAACTGGTGATCTCATGACATGGGTGTTAGTCCTCTTAGCTATGCATCAAGAATGGCAAAGCACTGCTCGAGAAGAAGT
TATACGTGTCCTTGGACCTAACGGGCTTCCCACACCAGACATCTTACAAGACCTCAAGACATTAGGTATGATAATCAATG
AGACGCTTCGGCTCTACCCTCCAGCGATGACACTAAACCGTGACACACTCAGGAAAGCTAAGCTAGGAAGCCTCGAGATT
CCTGAAGGAACTCAACTGTACTTATCGGTTGTCGCGATGCACCACGACAGAGAGGCATGGGGAGAAGACGCGGAGGAGTT
TAACCCGGGTAGGTTTGAAGACACCAGGAAAGAATCAGCTCTGCTTGTGCCGTTTGGGTTAGGGGTGAGGACTTGCGTGG
GACAGAACCTCGCAGTGGTTGAGGCCAAAACAGTTCTTGCCACGATCTTGAGGCATTACAGTTTCAGGTTGTCTCCAAGT
TATGTCCATGCTCCTGTTTTGTTTGTGACCTTGCAGCCTCAAAAAGGTGCTCATCTTCTCTTTAGTAGGATTTAA