Details for Kale Locus Bo6g119260

Position : C6 ( 5`- 37305271 .. 37308064 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119260

Protein [Map View]
MQTLPNSPPLLRRPGGDDDVDIDFRDVFGGPPKRRSKVVETTGRHSFSEIRRRDVIVDNSALILRDEKPVFGEDPSSIRR
RFTADDFFDDIFRVNESSSSSSPQRKIKNEQETFGSSLPGSRILSPARPIPHKVESPPGTSFPAQFSLPAKLIKGTEMPT
FGSAARSLSRNKEAASSSPLSRTSSKADDMVGSTASDGYVAPKVVNGKVRQFHFSIYKWPNKGVPVAMWGSSRLSSMAKA
EETTPSDLRPTSVEAEGKSSHNRPGVQKEEEMSEQAFSSNVSKAPDEAMVKPLHSFLDDKDERQGEDIVLEREEKKVKSK
AKSMRSSAGDSRSKKKAQGSRSPLDSPMPDKSNLASTSSVPEVSKDGAKGKVMDFVKIFSQGTSAGAGGEPLGQSSRWRA
KENPVTDINKDGAKAKETVKAPDQQKKSTPVTPAMDQDQKPSQATHKKVADSSKPSGVTEQEKRQEPSTAHVTSEDIDEP
FHVNFLVEDITQDENEMEETRNDAVEFQNIDAKIRKWSSGKSGNIRSLLSTLQYILWPGCGWKAVPLMDMIEGNAVRKSY
QRALLILHPDKLQQKGASANQKYMAEKVFELLQEAWDHFNTLGPV*

DNA
ATGCAGACACTACCAAACTCACCACCTCTCCTGCGTCGTCCCGGCGGGGACGATGACGTGGACATAGACTTCAGGGACGT
GTTCGGTGGTCCGCCTAAAAGACGGTCCAAAGTTGTTGAAACCACCGGTAGACATAGCTTCAGTGAAATCAGGCGGCGTG
ACGTCATCGTCGACAACAGCGCGCTGATTCTCCGAGACGAGAAGCCTGTGTTCGGGGAAGACCCGTCATCCATCCGTCGT
CGTTTCACTGCTGATGATTTCTTTGACGATATCTTCAGAGTGAATGAATCTTCATCATCATCTTCGCCGCAGAGGAAGAT
AAAGAACGAGCAAGAAACGTTCGGATCATCACTTCCGGGTTCTCGGATCCTTAGCCCGGCTCGTCCTATCCCTCACAAAG
TCGAGTCTCCTCCTGGGACTTCGTTTCCTGCACAGTTCAGTCTTCCTGCAAAGCTAATCAAAGGGACAGAGATGCCTACG
TTTGGTTCAGCTGCTCGGAGTTTAAGCAGGAACAAGGAAGCTGCTTCAAGTTCTCCTTTGTCAAGAACTTCAAGCAAAGC
TGATGATATGGTGGGGTCTACTGCTTCAGATGGTTATGTTGCTCCAAAGGTTGTTAATGGGAAAGTGAGGCAGTTTCACT
TCTCTATCTACAAGTGGCCTAATAAAGGAGTTCCTGTTGCCATGTGGGGCAGTTCTAGGTTGAGCTCTATGGCTAAAGCT
GAAGAGACGACACCTAGTGATTTGCGTCCTACTTCAGTTGAAGCAGAAGGAAAAAGCTCACACAATCGTCCTGGTGTTCA
GAAAGAAGAGGAGATGTCTGAACAAGCCTTCTCTAGCAATGTGTCTAAAGCTCCTGATGAGGCTATGGTGAAACCTCTAC
ATTCGTTTTTAGATGATAAGGACGAGAGACAAGGTGAGGATATAGTGTTAGAGAGGGAAGAGAAAAAAGTTAAAAGCAAA
GCGAAGAGTATGAGAAGCTCTGCAGGAGATTCAAGAAGCAAAAAGAAAGCACAAGGTAGTAGAAGTCCTTTGGATAGCCC
GATGCCTGATAAATCCAACTTGGCAAGTACATCTTCAGTACCAGAAGTTAGCAAAGATGGAGCCAAAGGGAAAGTGATGG
ACTTTGTTAAGATTTTTAGTCAAGGAACTTCAGCTGGAGCAGGTGGGGAACCTCTTGGGCAAAGCTCTAGATGGAGAGCT
AAAGAAAATCCTGTGACTGATATCAATAAAGACGGTGCTAAGGCCAAAGAAACTGTAAAGGCTCCTGATCAACAAAAGAA
ATCAACTCCAGTTACACCCGCCATGGACCAGGATCAGAAACCTTCACAGGCAACTCATAAAAAGGTCGCAGATAGTAGTA
AGCCTAGTGGTGTTACTGAACAAGAGAAGAGACAGGAACCTAGCACAGCACATGTTACCTCAGAGGATATAGACGAGCCC
TTCCATGTAAATTTCCTGGTGGAGGATATAACACAAGATGAGAACGAAATGGAAGAAACCAGAAATGATGCTGTAGAATT
CCAGAACATCGATGCTAAAATCCGCAAGTGGTCAAGCGGAAAGAGTGGAAACATCCGGTCTCTCCTGTCCACACTGCAAT
ATATTCTATGGCCCGGGTGTGGATGGAAGGCGGTTCCTCTCATGGACATGATCGAAGGAAACGCAGTTCGAAAATCGTAC
CAGAGAGCTTTACTAATCCTTCATCCAGATAAGTTACAACAAAAGGGTGCATCCGCAAACCAGAAATACATGGCTGAGAA
AGTTTTCGAGTTGTTACAGGAAGCATGGGACCATTTCAACACTCTCGGACCGGTTTAA