Details for Kale Locus Bo6g119250

Position : C6 ( 5`- 37301657 .. 37304017 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119250

Protein [Map View]
MSALTKLRSPVKPMVVEPRAILCSTGNRVKPSKTEIAAKKKKPQVAKSPAKSNFSASTDDSSSTTSSSERSSAKTAESKK
LITPSKRNGSVTKHNSVAAAGDILPESPGPVKRCHWITPNSDSIYVKFHDEEWGVPVRDDKKLFELLVFSQALAEFSWPS
ILHKRDAFRKLFEDFDPLAISEFTEKRLMSLKVNGCLVLSEQKLRAIVDNAKSVLKVKQEFGSFSNYCWRFVNHKPLRNG
YRYGRQVPVKSPKAEYISKDMMQRGFRCVGPTVIYSFLQVSGIVNDHLTTCFRYQECNAETETELDLHSIM*

DNA
ATGTCTGCACTCACTAAGCTTCGTTCTCCGGTTAAACCGATGGTTGTTGAGCCACGAGCAATCCTCTGTTCAACCGGGAA
CAGAGTCAAACCTTCGAAAACAGAGATCGCCGCGAAGAAGAAGAAGCCACAAGTGGCGAAATCTCCGGCGAAGAGCAACT
TTTCAGCCTCGACTGATGACTCATCTTCGACAACATCTTCCTCGGAGCGTTCGTCGGCGAAGACGGCAGAGTCTAAGAAA
TTGATAACTCCGTCGAAACGGAACGGGTCAGTGACGAAGCACAACAGTGTCGCCGCCGCTGGAGACATTCTTCCTGAGAG
TCCGGGACCGGTCAAGAGATGCCACTGGATCACACCTAACTCAGACTCGATCTACGTGAAGTTTCATGACGAGGAGTGGG
GTGTTCCAGTTCGTGACGACAAGAAACTCTTTGAGCTGCTTGTGTTCTCACAAGCATTAGCTGAGTTTAGCTGGCCCTCG
ATTCTACACAAAAGAGATGCCTTTAGGAAGCTCTTTGAAGATTTTGATCCTTTAGCTATATCAGAATTCACTGAGAAGAG
GTTGATGTCTCTTAAAGTAAACGGATGTCTTGTTCTGTCCGAACAGAAACTGCGAGCCATTGTCGATAACGCAAAATCAG
TTCTCAAGGTCAAGCAAGAGTTTGGATCATTCAGCAACTACTGTTGGAGATTTGTGAACCACAAGCCACTAAGAAATGGA
TACCGCTATGGTCGCCAAGTCCCTGTTAAATCCCCAAAGGCAGAGTACATTAGCAAAGATATGATGCAGAGAGGGTTCCG
CTGCGTTGGTCCTACTGTTATTTATTCCTTCTTGCAGGTCTCTGGCATTGTGAATGATCATCTCACAACTTGCTTCAGAT
ACCAAGAATGTAATGCTGAGACTGAGACCGAACTGGATCTGCATTCCATCATGTGA