Details for Kale Locus Bo6g119240

Position : C6 ( 5`- 37294348 .. 37298430 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119240

Protein [Map View]
MLEGDADNSKVINGGGFSQLQSCFGDCSSEEELTVLPRHTKVVVTGNNRTKSVLVGLQGVVKKAVGLGGWHWLVLTNGIE
VKLQRNALSVIEAPTGNEEDDDIEVEHIQWNNPSHMISDDSLKTHKAKQRGYRSARLSQKTMCRALSCDSHSKRQSITPR
ANMKVDLSKLDMPALQRYIQHFNLVDALPNPSKEQLLDIVQRHFMAQEMDELQVIVGFVQAAKGMKKACRWKSKEHQKH*

DNA
ATGCTGGAAGGTGATGCTGATAACTCAAAGGTCATCAATGGAGGAGGATTCTCTCAGCTACAGAGCTGCTTCGGAGATTG
CAGCAGCGAGGAGGAACTAACGGTGCTTCCACGTCATACGAAAGTGGTCGTCACCGGAAACAACCGTACGAAATCAGTTC
TCGTCGGTCTTCAAGGAGTCGTTAAGAAAGCCGTCGGACTCGGTGGCTGGCATTGGCTGGTTTTGACAAATGGAATCGAA
GTGAAGTTGCAGAGGAATGCACTTAGTGTCATTGAAGCTCCTACAGGGAACGAAGAAGACGATGATATTGAAGTCGAGCA
TATACAATGGAATAATCCCTCTCATATGATATCTGATGACAGTCTAAAGACTCATAAGGCGAAGCAAAGAGGATACAGAT
CAGCACGGTTATCACAAAAGACAATGTGCAGGGCCTTATCTTGTGACTCACACTCAAAAAGGCAGAGTATTACTCCTCGT
GCTAACATGAAGGTTGATCTTAGCAAATTGGATATGCCTGCGTTACAGAGATATATACAACATTTTAACCTCGTGGATGC
ACTTCCTAATCCATCAAAGGAGCAACTACTTGACATTGTTCAAAGACACTTCATGGCTCAGGAAATGGATGAGCTTCAGG
TTATTGTGGGATTCGTTCAAGCTGCAAAAGGAATGAAGAAGGCTTGCAGGTGGAAATCAAAAGAACATCAGAAACACTGA