Details for Kale Locus Bo6g119210

Position : C6 ( 5`- 37283671 .. 37289419 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119210

Protein [Map View]
MVDFVGGSCRRETLGKMESSDVADGIIESEPHPSTLPCRRPLVVTGRDLNQQSADSITFRENARSEANMVARSSGGASDT
QKPSDLASQHSGGVDLVVLLPQKRAAPMVEDECTMSAVNRGDSGMDSAGGVAAFATEDSCPSTAWQGTLTRIDDNNLGAG
GFQLNPGASVQLTASSEWSGHVWARTGCKFDSSGHGNCVTGDCGGDSSVAMAEFTHGEKDSYDVRLVDGTNVKVGVKPQG
DNNYLITFYPATGHIAGSSTEFTLQNNCPYTVWPGILSGNILSDGGFRLSPNASVQLTPPSRWSGRIWARTGCNFSSSGQ
GKCATGDCGGVLKCAAAGGVPPVTLAEFAIGDTDFYDVSLVDGYNVKIGIKPQGDCKYAGCSSDLNSICPNELRVMDPHN
NVVACKSACEAFNTTEYCCTGAFDKPETCPPTDYSRIFKKA*

DNA
ATGGTTGACTTTGTCGGAGGTAGTTGTCGGAGGGAGACGCTTGGCAAGATGGAGTCTAGTGATGTAGCGGATGGTATAAT
CGAGTCAGAACCACACCCCTCGACATTACCGTGTCGGAGGCCGCTAGTAGTAACCGGAAGAGACCTCAACCAACAATCAG
CAGACTCAATAACGTTCAGAGAAAATGCACGAAGCGAAGCCAACATGGTGGCGAGGAGTAGTGGAGGCGCTTCAGATACA
CAAAAGCCTTCAGATCTGGCGAGCCAACACTCGGGAGGAGTAGATCTGGTAGTTTTGCTTCCACAGAAAAGAGCGGCGCC
GATGGTTGAAGACGAATGTACGATGTCGGCGGTGAACAGAGGAGACTCAGGCATGGACTCCGCTGGCGGAGTTGCTGCTT
TCGCTACCGAAGACAGTTGTCCATCCACCGCTTGGCAAGGAACTCTCACAAGAATAGACGATAACAACCTCGGCGCCGGG
GGATTTCAGTTGAATCCAGGCGCTTCCGTTCAACTCACCGCTTCTTCCGAATGGTCAGGCCACGTCTGGGCTCGTACGGG
CTGTAAATTCGACTCATCGGGCCACGGTAACTGCGTCACCGGAGACTGCGGCGGAGATAGTTCAGTTGCAATGGCAGAAT
TTACTCATGGAGAAAAGGATTCCTACGACGTGAGGCTCGTTGACGGTACCAATGTCAAGGTGGGAGTAAAACCCCAAGGA
GATAATAACTATTTGATCACTTTCTACCCCGCCACAGGCCACATTGCCGGTTCCTCCACCGAATTCACTTTACAAAACAA
TTGCCCTTACACCGTCTGGCCGGGAATTCTCTCCGGCAACATCCTCTCCGACGGCGGTTTTCGATTAAGTCCAAACGCTT
CGGTACAGCTCACCCCTCCTTCGAGATGGTCAGGCCGCATCTGGGCTCGTACCGGCTGCAACTTCAGCTCATCCGGCCAA
GGCAAATGCGCCACCGGAGACTGTGGCGGCGTTCTTAAATGTGCTGCCGCCGGCGGAGTTCCTCCAGTCACATTGGCCGA
ATTCGCCATCGGAGACACTGATTTCTATGACGTGAGTCTCGTCGACGGCTACAATGTCAAGATTGGGATAAAGCCTCAAG
GAGACTGCAAATACGCAGGCTGCTCCTCCGACCTCAACTCGATTTGCCCTAACGAGCTTCGTGTCATGGATCCACATAAC
AACGTGGTGGCGTGCAAGAGCGCCTGCGAGGCGTTTAACACGACGGAATATTGCTGCACGGGAGCTTTCGATAAGCCGGA
AACTTGTCCTCCGACGGATTACTCGAGGATCTTCAAGAAAGCTTAG