Details for Kale Locus Bo6g119140

Position : C6 ( 5`- 37255783 .. 37256982 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119140

Protein [Map View]
MSRSAECWEFSGERKRLLEKKPSFSQTCSRLSRYLKEKGSFGDLSLGMTCNGVFGVTRQQPTMMNLFPVEDSSDVKQKND
VFPRQSSFSSSSSSGAKEEVEKITENESVKVESQSSAPLTIFYGGQVMVFDDFPAEKAKQVIDLAHKVSAKSFTAEMNRN
QSAYTHKEIASTTPVPVPSPVKTAAPEPIQTHKSSLACELPIARRASLHRFLEKRKDRISSKAPYQIDGSTEASSKPNTA
WLGSQ*

DNA
ATGTCGAGGTCTGCCGAGTGTTGGGAGTTTTCCGGCGAGAGGAAGAGGTTGCTCGAGAAGAAGCCGAGCTTCTCGCAGAC
ATGTAGTCGGTTGAGTCGGTATCTGAAGGAGAAGGGTAGCTTCGGAGATCTGAGCTTGGGGATGACTTGCAATGGAGTTT
TTGGTGTGACACGTCAGCAGCCGACGATGATGAATCTCTTCCCTGTTGAAGATTCTTCGGACGTAAAACAGAAGAACGAT
GTGTTTCCTCGGCAATCAAGCTTCTCTTCCTCCTCTTCCTCTGGAGCCAAGGAAGAAGTTGAGAAGATCACAGAGAATGA
ATCAGTGAAGGTGGAGTCTCAATCTTCTGCTCCGTTGACTATATTCTACGGTGGTCAAGTTATGGTGTTTGATGATTTTC
CTGCTGAGAAAGCCAAGCAAGTCATTGACTTGGCTCACAAGGTAAGTGCTAAAAGCTTCACAGCTGAAATGAACCGTAAC
CAGAGTGCTTATACTCATAAAGAGATTGCTTCCACTACCCCAGTTCCAGTTCCTAGTCCTGTGAAAACAGCAGCACCAGA
GCCTATCCAGACCCACAAGTCCTCTTTAGCTTGCGAACTCCCAATTGCTAGAAGAGCTTCACTTCATCGTTTCCTTGAGA
AGAGAAAGGATAGGATTTCGTCAAAGGCACCGTACCAGATAGACGGTTCAACCGAAGCATCTTCCAAGCCTAACACAGCT
TGGCTCGGTTCCCAGTAA