Details for Kale Locus Bo6g119110

Position : C6 ( 5`- 37243740 .. 37246275 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119110

Protein [Map View]
MGSSMDEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQIYLVGFYEEREFALYVSAISN
ELKVPVRYLREDKPHGSAGGLYHFRNLIMEDDPSHIFLLNCDVCCSFPLPEMLEAHREYGGIGTLLVIKVSPELASQFGE
LVADPVTNELLHYTEKPETFVSDRINCGVYVFTPDIFTAIRDVSSQTKDTATLRRVSSVEALQPATRNSTDFVRLDQDIL
SPLAGKKQLYTYETMDFWEQIKSPGMSLRCSELYLSQFRLTSPQVLASGDGTKSAIVIGDVFIHPSAKVHPTAKIGPNVS
ISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSSIGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSIVL
PNKTLNVSVQDEIIL*

DNA
ATGGGGAGCTCAATGGATGAGAAAGTGGTTGCTGTGATCATGGTCGGTGGTCCAACCAAAGGTACTCGATTCCGACCATT
GTCCCTGAATATTCCAAAGCCTCTGTTTCCTATTGCGGGACAACCAATGGTGCATCATCCAATTTCAGCGTGTAAAAGGA
TTCCAAACTTAGCTCAAATCTATCTTGTTGGTTTCTATGAGGAAAGGGAGTTTGCACTTTATGTCTCTGCCATCTCCAAC
GAACTCAAAGTTCCTGTCAGATATCTGAGAGAAGACAAGCCACATGGTTCTGCTGGTGGTCTGTATCACTTTAGAAATCT
AATCATGGAAGATGACCCGTCTCATATCTTCCTGCTCAACTGTGATGTTTGCTGCAGTTTCCCCTTGCCTGAAATGCTCG
AGGCTCATCGGGAATATGGTGGAATTGGAACACTTCTTGTGATCAAGGTCTCTCCTGAATTAGCCAGCCAGTTTGGAGAA
CTGGTTGCGGATCCAGTTACTAATGAGCTGCTTCATTACACCGAGAAACCTGAAACTTTTGTCAGTGACCGTATTAACTG
CGGTGTTTATGTATTTACACCTGACATTTTTACTGCCATAAGAGATGTTTCTTCTCAAACGAAAGATACAGCAACTCTGA
GACGTGTTTCCAGCGTTGAAGCTCTTCAACCGGCAACAAGGAACTCCACGGATTTTGTAAGACTGGATCAAGACATCCTT
TCACCTCTAGCTGGGAAGAAACAGCTATATACTTACGAGACTATGGATTTCTGGGAGCAAATTAAATCTCCTGGAATGTC
GCTGAGGTGCTCGGAACTCTATCTTTCTCAATTCAGGTTGACCTCACCACAAGTGCTGGCTAGTGGTGATGGAACAAAGA
GTGCCATAGTGATTGGTGATGTTTTCATACATCCTTCTGCAAAAGTACACCCAACTGCCAAGATTGGTCCCAACGTCTCA
ATCTCTGCAAATGCTCGTGTTGGACCGGGTGTCAGGCTTATCAGCTGTATCATCCTTGATGACGTTGAGATCATGGAAAA
TGCAGTGGTGACTAACGCAATTGTTGGGTGGAAATCTTCTATCGGGAGATGGTCACGTGTCCAGGCTGAGGGAGTCTACA
ACTCCAAACTCGGAGTTACAATTCTCGGAGACTCGGTTGCAGTTGAAGACGAAGTTGTGGTGACCAGCAGTATCGTTCTT
CCAAACAAGACACTCAACGTCAGTGTTCAAGACGAGATCATCTTGTAA