Details for Kale Locus Bo6g119100

Position : C6 ( 5`- 37241976 .. 37243409 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119100

Protein [Map View]
MNRLFIKSLCTSSAAGANLKPPPPDPAAISNLILSSPIQSPLPSNTPWTPHLVNSILKRLWNHGPKALHFFHLLDRRHRN
YIHSPSSFNLAIDIAARLHLHTTVWSLIRRMRSLRIGPSPKTFAIVAERFASSGKPDKAVNLFLNMHEHGCSQDLASFNT
ILDVLCKSKRVEKAYELFKDLRGRFSADVVTYNVIVNGWCLIKRTPKALEVLKEMVERGISPNLTTYNTMLKGFFRSGQV
RQGWEFFLEMKKRNCGVDVVTYTTVVHGLGVSGEVKRAKKVFDEMIREGVLPSVATYNALIQILCKKDTVENAVLVFEEM
LRKGYEPNVTTYNVLIRGLFHAGEFTRGEEMMRRMEEEGGCEASFQTYNMMIRYYSECGEVEKSLGLFERMGSGGCLPNL
DTYNILISGMFVRKRSEDMVVAGKLLVEMVERGFVPRRFTFNRVLNGLLLTGNQGFAKEILRSQSKSGSRLTKNFRL*

DNA
ATGAATCGTCTCTTCATCAAATCGCTCTGCACTTCCTCCGCCGCCGGCGCCAACCTAAAACCCCCACCGCCCGATCCCGC
CGCCATCTCCAACCTCATCCTCTCTTCCCCCATCCAATCCCCACTCCCCTCAAACACCCCATGGACCCCACACCTCGTGA
ACTCAATCCTAAAACGCCTCTGGAACCACGGCCCGAAGGCCCTCCACTTCTTCCACCTCCTCGACCGCCGCCACCGCAAC
TACATCCACTCCCCCTCCTCCTTCAACCTCGCGATCGACATCGCCGCCCGCCTCCACCTCCACACCACCGTCTGGTCCCT
GATCCGCCGCATGCGCTCCCTCCGCATCGGCCCCTCCCCGAAAACCTTCGCGATCGTCGCCGAGAGGTTCGCCTCCTCCG
GGAAGCCCGATAAAGCCGTGAACCTCTTCCTCAACATGCACGAGCACGGCTGCTCTCAAGATCTCGCTTCCTTCAACACG
ATCCTCGATGTCCTCTGCAAATCCAAACGCGTGGAGAAAGCTTACGAGCTCTTTAAGGATCTTAGAGGAAGGTTTAGTGC
TGACGTGGTTACCTACAATGTTATTGTGAACGGTTGGTGTTTGATCAAACGAACCCCAAAGGCTTTGGAGGTGTTGAAAG
AGATGGTTGAGAGAGGGATAAGCCCTAACCTCACCACTTACAACACAATGCTCAAAGGCTTCTTTAGGTCAGGGCAGGTG
AGGCAGGGATGGGAGTTTTTCTTGGAGATGAAGAAACGTAATTGTGGAGTCGATGTTGTGACCTATACTACAGTTGTTCA
CGGGCTCGGCGTCTCTGGGGAGGTTAAGAGAGCTAAGAAAGTCTTCGACGAGATGATTAGAGAAGGAGTGCTACCTTCTG
TAGCCACGTACAATGCGTTGATCCAGATTCTGTGTAAGAAAGATACCGTGGAGAACGCGGTTTTGGTGTTTGAGGAGATG
TTGAGGAAAGGTTATGAACCGAATGTGACGACTTACAATGTGTTGATAAGAGGGTTGTTCCACGCCGGGGAGTTCACTCG
AGGAGAGGAGATGATGCGGAGGATGGAGGAGGAAGGTGGGTGTGAGGCGAGCTTCCAGACGTATAATATGATGATAAGAT
ATTATTCGGAGTGCGGCGAGGTTGAGAAATCGTTGGGGTTGTTTGAGAGGATGGGGAGTGGAGGTTGCTTGCCGAATTTG
GATACTTATAATATACTGATAAGTGGGATGTTTGTGAGGAAGAGATCGGAGGATATGGTGGTGGCTGGTAAGCTGTTGGT
TGAGATGGTTGAGAGAGGGTTTGTACCGAGGAGGTTTACTTTTAATCGGGTTCTGAATGGGCTTCTTTTGACTGGGAATC
AAGGTTTCGCGAAGGAGATCTTGAGGTCGCAGAGTAAATCTGGTAGCCGGCTTACTAAGAACTTCAGGCTATGA