Details for Kale Locus Bo6g119070

Position : C6 ( 5`- 37234817 .. 37235911 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119070

Protein [Map View]
MALGDLSSSSTSELHVLAVDDSIVDRKVIERLLRISACKVTTVESGTRALQYLGLDGDKGSSGLKDLKVNLIVTDYSMPG
LTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCMTEGAEDFLLKPVKLADVKRLKELIMRGGEAEQEKTSNLISSPK
RILQNNIFFFFIIFFIITIIVIFIV*

DNA
ATGGCACTAGGAGATTTATCTTCTTCTTCTACCTCGGAGTTACATGTTCTCGCTGTGGATGATAGTATTGTTGATCGTAA
GGTTATTGAGAGGTTACTTAGGATCTCTGCTTGTAAAGTGACGACTGTTGAGAGTGGGACTAGGGCTCTTCAGTATCTTG
GTCTAGATGGAGACAAAGGATCTTCTGGTCTTAAGGATTTGAAGGTGAACTTGATAGTGACAGATTACTCTATGCCGGGA
CTAACAGGATATGAACTACTCAAAAAGATCAAAGAGTCTTCAGCATTCAGAGAAATACCAGTAGTGATAATGTCGTCTGA
GAACATACAACCTCGTATAGAACAATGCATGACAGAAGGAGCAGAGGATTTTCTGCTAAAACCGGTGAAATTAGCAGATG
TGAAGCGGCTTAAAGAACTCATAATGAGAGGTGGTGAAGCTGAACAAGAGAAAACCAGTAACCTTATTAGTAGTCCTAAG
AGAATCCTTCAAAACAACATCTTCTTCTTCTTCATCATCTTCTTTATTATCACTATAATCGTCATCTTCATCGTCTAA