Details for Kale Locus Bo6g119050

Position : C6 ( 5`- 37232036 .. 37233158 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119050

Protein [Map View]
MVADSITDSQLFHESPISRDFVKKRKANWFWKLKQWKIDARRRQWIYQWKRASVGEAGLRSLRDKLIDRNTVNDTYLESW
SIDDHHDGLRCYDDSDDDETDLSASSPTSVLKNKDSDSNKSVHGCFCCSNQITEEEEEEEDAFDDAYDNWEDFSDALNSF
ESDEDSHRKKKSSPHKDKCKQEASPEKAIHHKKKNKKKKKSDQKKEGDGGDEEISDCPICSEEMDATDLSFLPCPCGFRL
CLFCHKQINENDGRCPACRNKYEQTSSHNSGEVSFQQRARGTVRLSPSFKGLLT*

DNA
ATGGTTGCTGACTCGATCACAGACTCTCAACTCTTCCATGAGTCTCCGATTTCGAGAGATTTCGTCAAGAAACGTAAGGC
GAATTGGTTTTGGAAGCTGAAGCAGTGGAAGATCGATGCTCGTCGCAGGCAATGGATTTACCAATGGAAGAGAGCAAGCG
TAGGTGAAGCAGGGCTGAGATCTTTGCGTGACAAGCTGATTGATAGAAATACAGTAAATGATACATACCTTGAATCTTGG
AGTATTGATGATCATCATGATGGACTACGATGCTATGATGATAGTGATGACGATGAGACTGATCTCTCTGCTAGTAGCCC
CACTAGTGTCCTCAAGAACAAAGACTCCGATAGTAATAAGAGCGTCCACGGCTGCTTCTGCTGTTCTAATCAGATCACCG
AGGAAGAGGAAGAGGAAGAAGACGCTTTTGATGATGCGTATGACAACTGGGAAGACTTTAGCGATGCCTTGAACAGCTTT
GAGAGCGACGAAGATAGCCACAGGAAGAAGAAGTCTTCTCCTCATAAAGACAAGTGCAAGCAAGAAGCTTCACCAGAGAA
GGCGATTCATCACAAAAAGAAGAATAAGAAGAAGAAAAAGTCTGATCAGAAGAAAGAAGGTGACGGTGGTGATGAAGAGA
TAAGTGATTGTCCTATTTGCTCTGAAGAGATGGATGCAACGGATCTAAGCTTCTTACCATGTCCTTGCGGGTTTCGGCTG
TGTCTCTTCTGCCATAAGCAGATCAACGAGAACGATGGACGTTGCCCAGCTTGCAGGAACAAGTATGAGCAGACGAGTAG
TCACAACAGTGGGGAAGTTAGTTTCCAGCAGCGTGCCCGTGGCACAGTTCGTTTGTCTCCATCGTTTAAAGGACTTTTGA
CATAG