Details for Kale Locus Bo6g119040

Position : C6 ( 5`- 37228552 .. 37230803 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119040

Protein [Map View]
QTLQVKEREEKKEPTFFAFLSSWRVFDLGRKTKKSHNRFSATALSALMGDSETLAALKRAYADTILNTTKEAAARVLSSE
KKTRMYQQEIVTVKDEAITTLLRLKQMYDSKVKETEEMSLKQQQKVEELEAQLGEAEDIVGELRMELRALHDELNKVTNG
NTSYLKGDQEVSCRKASDAAVSSSHERSGAVPVEQSGSVVAYGITNQSLARINSIKRCSSKDSMDRCHHTLPSILTKRRE
VEGCTQMIHAVDKKNMANGDGKDPMVSQNTSPKEHEQNRRTVISATEARKEEKEILASSMCEETPVLAAASKNRCIKYTF
KRKRKKEASSNLEGDSSFEESRNVKQKTGEKDDGYLESLKPSFTGESSRDSLCVAQVARQLVPFSKKNSFAAELVNQ*

DNA
CAGACGCTTCAAGTAAAAGAGAGAGAAGAAAAAAAAGAACCAACCTTTTTCGCCTTTCTTTCTTCTTGGCGAGTCTTCGA
CCTTGGTCGGAAAACAAAAAAATCTCATAATCGCTTCTCCGCAACCGCATTATCGGCTCTAATGGGCGACTCCGAGACCT
TAGCGGCGTTGAAGAGAGCCTACGCGGATACGATACTCAACACGACGAAGGAGGCGGCGGCGCGTGTGTTGTCTTCTGAG
AAGAAGACGCGCATGTATCAGCAAGAGATTGTGACGGTTAAAGACGAAGCTATTACTACGCTGCTTAGGCTTAAACAGAT
GTATGATTCAAAGGTGAAGGAGACAGAAGAGATGTCCTTGAAGCAGCAACAAAAGGTTGAGGAACTTGAAGCTCAGCTTG
GAGAAGCTGAAGATATTGTAGGGGAGCTGAGGATGGAACTTCGAGCACTTCATGATGAGCTCAACAAAGTTACCAATGGT
AACACATCATATCTTAAAGGTGACCAGGAAGTCTCTTGTCGAAAAGCAAGTGATGCAGCAGTTTCTAGCAGTCATGAGCG
ATCAGGAGCTGTCCCAGTTGAACAAAGTGGTTCGGTGGTGGCTTACGGGATCACAAACCAATCTTTGGCTCGCATAAATA
GTATCAAACGGTGTTCTTCTAAAGATAGCATGGATCGATGTCACCACACTCTTCCGTCTATATTGACAAAGCGCAGGGAG
GTTGAAGGATGTACACAGATGATTCACGCAGTAGATAAGAAGAATATGGCCAATGGAGATGGAAAAGACCCAATGGTGTC
TCAAAACACATCTCCGAAGGAACATGAACAGAACAGAAGGACTGTGATTAGCGCAACAGAGGCAAGGAAGGAAGAAAAAG
AGATTTTGGCATCTTCTATGTGTGAAGAAACTCCAGTTTTGGCTGCTGCTAGTAAGAACCGGTGTATCAAGTACACATTC
AAGAGGAAGAGAAAGAAGGAGGCTTCAAGCAATCTTGAAGGAGATTCATCCTTTGAGGAGAGCAGAAACGTGAAACAGAA
GACTGGGGAGAAAGACGATGGTTATTTGGAATCTCTGAAGCCTAGCTTCACCGGTGAATCATCTAGGGATAGTCTCTGCG
TAGCACAGGTGGCTCGGCAGCTTGTACCATTCTCGAAGAAGAATAGTTTTGCAGCAGAACTAGTCAACCAGTAG