Details for Kale Locus Bo6g119010

Position : C6 ( 5`- 37217418 .. 37218453 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119010

Protein [Map View]
MADGSSCSSDSGCISREIMLFGVRVVLDPMRKSVSLNNLSEYEQTEEIPKIIIAEDEKNKTSSGYASADDAVPISSSRER
KRGVPWTEEEHKLFLLGLKKVGKGDWKGISKNFVKSRTSTQVASHAQKYFLRRSNLNRRRRRSSLFDMTTDTVMPMEKDQ
MLMHENMSQPSSLVPEIKIHPVMQIFPEFPVPTSGDNASRNHLVPFTFQARPEPISLSLTLASSNLNDPSSSRHSAFNTI
GVA*

DNA
ATGGCGGATGGTAGTAGTTGTTCGTCGGATTCAGGCTGCATCAGTAGAGAGATCATGCTGTTTGGTGTCAGGGTGGTTCT
TGATCCGATGAGAAAGAGTGTGAGTTTGAACAACTTGTCTGAGTACGAGCAGACGGAGGAGATCCCAAAGATCATCATCG
CCGAGGATGAAAAGAACAAAACCTCCTCTGGTTACGCCTCCGCGGACGACGCTGTTCCGATCTCTTCTAGCCGAGAGAGG
AAACGAGGAGTTCCATGGACAGAGGAAGAGCACAAGCTGTTCTTGCTTGGGCTGAAGAAAGTAGGGAAAGGAGATTGGAA
AGGAATATCTAAAAACTTTGTCAAGAGCAGGACGTCTACGCAAGTAGCTAGTCACGCTCAGAAATACTTCCTCCGGCGAA
GTAATCTCAACCGTCGCCGGCGAAGATCTAGCCTCTTTGACATGACAACTGACACGGTCATGCCCATGGAAAAAGATCAG
ATGCTTATGCATGAGAACATGTCACAACCATCTTCTCTTGTACCTGAGATCAAGATACACCCGGTTATGCAAATCTTTCC
TGAGTTCCCGGTACCAACATCTGGTGATAATGCATCAAGGAACCATCTGGTTCCATTTACTTTTCAAGCAAGGCCTGAAC
CCATCTCTCTCAGCCTCACACTAGCCTCATCTAATCTTAATGACCCGTCTTCCTCAAGGCACTCAGCATTCAACACGATT
GGAGTTGCTTAG