Details for Kale Locus Bo6g119000

Position : C6 ( 5`- 37214123 .. 37215844 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g119000

Protein [Map View]
MMFKRSFKTFVEQELGSFPKFLIYTVLEWILITALFVDGVLAFLSNQYARFFDLNAPCLLCTRIDHVLVPRDPHFYYNDS
ICDSHKRKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDCDTYKSLIGILHKDLEVLIEDERDLPLGLKKQDDLVQT
TTHLIDYKTDSLKQHCSCCGELLKTKSEKFLKKNNSFLAPAPSPRVSYNKLSENESEFKDFDVEERTPSFVRGGNKFFGV
PLSDSAQNSPRWSVRSLRKPSLDKIEIPDSNGESILNQLKKEVRLDKKSLIDLYMELDEERSASAVAANNAMAMITKLQA
EKSAIQMEALQYQRMMDEQAEYDQEALQSMSSDLAKKEEEFKELEAEFEAYRERYGCLTDDEASGDEFLEEHGDARADDE
ASGDEFLEEHGNARADDDCQETKPDSDFEDCSSNHEEDVENIDQNRSCKSEEFGLLVQMKKSSEESTEVNGASAEEEKGS
VRKEGIVKELSEITERLSALQSDGELLKHIADVSEGEAMILQISQNLHMLRSSFVAMPSES*

DNA
ATGATGTTTAAACGCTCTTTTAAGACCTTCGTTGAACAAGAACTCGGATCTTTCCCTAAATTCCTCATCTACACCGTCCT
CGAATGGATCCTCATCACCGCCCTCTTCGTCGACGGCGTTCTCGCCTTTCTATCAAACCAATACGCCAGATTCTTCGATC
TCAACGCTCCTTGTCTCCTCTGCACCAGAATCGACCACGTTCTTGTCCCTAGGGATCCTCATTTCTATTACAACGACTCG
ATCTGCGACTCTCACAAGAGGAAAGTTTCTTCCCTTGCTTATTGCCACGTCCACAAGAAACTCTCCGAGATCAAACACAT
GTGTGAAGGATGTCTTCTCTCTTTCGCTACCGAGAAAGAATCTGATTGTGATACGTATAAGTCTCTCATTGGGATCTTAC
ATAAAGATCTTGAGGTTCTTATAGAAGATGAAAGAGATCTTCCCTTGGGGCTCAAGAAACAGGACGATCTTGTTCAGACA
ACAACGCATCTGATAGATTACAAGACAGATAGCTTGAAACAACATTGTTCGTGTTGTGGAGAATTATTGAAGACGAAATC
TGAAAAGTTTTTAAAGAAGAACAATTCTTTCCTAGCTCCTGCTCCTTCTCCTAGGGTTTCGTACAACAAGCTGTCTGAAA
ACGAGTCTGAGTTTAAGGACTTTGATGTGGAGGAGAGAACACCGAGTTTTGTAAGAGGAGGCAACAAGTTCTTTGGGGTT
CCTCTGTCTGATTCAGCGCAAAACAGTCCAAGATGGTCCGTTCGATCTCTCAGGAAACCCTCTTTGGATAAGATTGAGAT
ACCTGATTCAAACGGTGAATCCATCCTTAATCAGCTCAAGAAAGAGGTTCGCTTGGACAAGAAGTCACTGATAGATCTGT
ACATGGAGTTAGATGAAGAGAGGAGTGCTTCAGCTGTTGCAGCCAACAACGCGATGGCTATGATCACAAAGCTGCAAGCC
GAAAAATCGGCTATTCAAATGGAGGCATTGCAGTACCAAAGAATGATGGATGAACAGGCTGAGTATGACCAAGAGGCTTT
GCAGTCTATGAGTAGTGACTTGGCGAAGAAGGAAGAGGAGTTTAAGGAACTTGAAGCTGAATTTGAGGCTTATAGAGAGA
GGTACGGATGTTTAACCGATGATGAAGCCTCGGGAGATGAGTTTCTTGAAGAACACGGTGACGCTAGGGCAGATGATGAA
GCCTCAGGAGATGAGTTTCTTGAGGAACACGGTAATGCTAGAGCAGATGATGACTGCCAAGAAACCAAACCAGACTCTGA
CTTTGAAGATTGTTCTTCAAATCATGAGGAGGATGTAGAAAACATTGATCAAAATAGGTCTTGTAAATCTGAAGAATTTG
GACTTTTGGTACAAATGAAAAAAAGCTCAGAAGAGTCTACTGAAGTAAATGGTGCATCTGCAGAGGAAGAGAAAGGAAGT
GTAAGAAAAGAAGGGATAGTGAAAGAGCTTTCAGAGATCACAGAGAGGCTAAGTGCACTTCAGTCAGATGGTGAACTGTT
GAAACATATTGCAGATGTTAGTGAAGGAGAAGCAATGATATTGCAAATATCTCAGAACTTGCACATGCTTCGTAGTAGTT
TTGTTGCCATGCCTTCAGAATCATGA