Details for Kale Locus Bo6g118990

Position : C6 ( 5`- 37208085 .. 37211206 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g118990

Protein [Map View]
MKKPKSSKPEKIDKLDLFSSLWKQRSFRVIIAVGLLYLLMVTVEIPLVFKSWSSTSVSIDSLSRPEKLETEQDPPQIEII
SNPPPKPDSKPTLNREHHRGLLSSLRFDSETFDPSSKDGSVELHKSAKEAWQLGRKLWKELESGRLEKSVEKPENKTDSC
PHSVSLTGSEFMNRENKLMELPCGLTLGSHITLVGRPRKSYPKGGDGDGSMLVSQFVIELQGLKTVDGEDPPRILHFNPR
LKGDWSRRPVIEQNTCYRMQWGSSQRCEGWRSRAEEETVDSHVKCEKWIRDDDNYSEGSRARWWLNRLIGRRKRVKVEWP
FPFVEEKLFVLTLSAGLEGYHINVDGQHVTSFPYRTGFTLEDATGLTVNGDIDVHSVVVASLPTSHPSFAPQRHLELSKR
WQAPLVPDGPVELFIGILSAGNHFGERMAVRKSWMQHVLITSSKVVARFFVALHGRKEVNVELKKEAEYFGDIVLVPYMD
SYDLVVLKTVAICEHGALAYSAKYIMKCDDDTFVKLGAVINEVKKVPEGRSLYIGNMNYYHKPLRGGKWAVTYEEWPEED
YPPYANGPGYVLSSDIARFIVEEFERHRLRLFKMEDVSVGMWVEHFKNTSNPVDYRHSLRFCQFGCVENYYTAHYQSPRQ
MICLWDKLLRQNKPECCNMR*

DNA
ATGAAGAAACCCAAATCGTCGAAACCCGAAAAAATCGACAAGCTCGATCTCTTCTCATCACTATGGAAGCAGAGATCTTT
CCGCGTAATCATAGCAGTAGGGCTCCTCTATCTCCTAATGGTCACTGTCGAGATACCCCTCGTGTTCAAATCCTGGTCCT
CCACCTCCGTCTCCATCGATTCTCTCTCCAGACCCGAGAAGCTCGAAACAGAGCAAGACCCGCCCCAAATCGAGATCATC
TCTAATCCACCTCCTAAACCGGATTCTAAACCGACCCTTAACCGTGAACACCACAGAGGTCTTCTCTCGAGCCTTAGATT
CGACTCGGAAACTTTCGACCCGAGTAGCAAAGACGGGTCAGTGGAGCTTCACAAGTCAGCCAAGGAGGCGTGGCAGCTAG
GGAGGAAGCTCTGGAAGGAGCTCGAGTCAGGGAGGCTTGAGAAGTCAGTGGAGAAGCCCGAGAATAAGACAGATTCTTGT
CCGCACTCTGTTTCGTTAACCGGGTCTGAGTTCATGAACCGGGAGAATAAGCTGATGGAGCTGCCCTGTGGTTTGACGTT
GGGCTCGCATATCACTTTGGTTGGGAGGCCGAGGAAGAGTTATCCTAAAGGAGGAGATGGAGACGGGTCTATGTTGGTTT
CTCAGTTTGTGATTGAGCTTCAGGGTTTGAAGACTGTTGATGGAGAGGATCCTCCTCGGATCTTGCATTTTAACCCGAGG
CTTAAGGGGGATTGGAGCAGAAGGCCGGTGATTGAGCAGAACACTTGTTATAGGATGCAGTGGGGTTCTTCGCAGCGGTG
TGAAGGGTGGAGGTCAAGAGCTGAGGAAGAGACTGTTGATAGTCATGTGAAGTGTGAGAAGTGGATCCGTGATGATGATA
ACTACTCAGAAGGGTCGAGGGCGAGATGGTGGCTGAACAGACTCATAGGAAGGAGGAAAAGAGTCAAAGTAGAATGGCCG
TTTCCTTTTGTGGAAGAGAAGCTCTTTGTTCTCACTCTCAGCGCTGGTTTAGAAGGTTACCATATCAATGTTGATGGACA
GCACGTTACATCTTTCCCTTATCGCACCGGTTTCACACTAGAGGATGCAACAGGACTGACTGTGAACGGAGACATTGATG
TTCACTCTGTGGTTGTTGCCTCTCTGCCAACATCACACCCCAGTTTTGCTCCCCAGAGGCATCTCGAGTTGTCGAAAAGA
TGGCAGGCTCCTTTAGTACCCGATGGGCCTGTGGAGCTTTTTATCGGTATTCTTTCAGCAGGGAATCATTTCGGAGAACG
GATGGCTGTGAGGAAGTCGTGGATGCAGCATGTTCTTATCACATCTTCAAAAGTTGTTGCTCGTTTCTTTGTGGCACTCC
ATGGGAGGAAAGAGGTGAATGTGGAACTGAAGAAAGAAGCAGAGTATTTTGGGGACATTGTGCTTGTTCCTTACATGGAT
AGCTATGATCTTGTCGTCCTCAAAACTGTTGCCATATGTGAACACGGAGCTCTTGCATACTCTGCAAAGTATATAATGAA
GTGTGACGATGATACATTTGTGAAACTTGGCGCAGTGATCAATGAAGTGAAGAAAGTACCCGAAGGTAGAAGCTTGTATA
TTGGTAACATGAATTATTACCACAAACCTCTTCGTGGTGGTAAATGGGCTGTCACATACGAGGAATGGCCAGAGGAAGAC
TATCCACCCTATGCAAATGGACCTGGGTATGTTTTGTCTTCTGACATTGCACGCTTCATCGTTGAAGAGTTTGAGAGACA
CAGATTACGGCTGTTCAAGATGGAGGACGTGAGTGTGGGAATGTGGGTGGAGCATTTCAAAAACACATCAAACCCAGTGG
ACTACAGACACAGTCTGAGATTTTGCCAGTTCGGTTGTGTTGAGAACTACTACACAGCTCATTACCAGTCGCCAAGACAG
ATGATATGCTTATGGGACAAGCTCTTAAGACAGAACAAGCCAGAGTGTTGTAACATGAGATGA