Details for Kale Locus Bo6g118960

Position : C6 ( 5`- 37192024 .. 37197332 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g118960

Protein [Map View]
MADGGHLHHLPPENASEVATVENTKLADAPVLFFVYFHKAFRAQLVELRRLATDAAEAGSFSGDLAGELCRKFEFLKLVY
KYHSAAEDEVIFLALDSRVKNIVSNYSLEHDGTDDLFTSIFHWLNVLEHELGNISDVLREVMLCIGTIQSSVCQHMLKEE
RQVFPLLIEKFTFQEQASLVWQFICSVPVMVLEDFLPWMMSYLSHKERTEVVNCMKDVVPTEDSSQQIKDFLKVISSWLM
DCEASTKILKQVEYEDVSKDTKNLSRSGCFQRLWQWSKKPVFIPNVGHSPIHGLQIFQNAVEKDLRDIQEGLCQASFPSL
LLDLDVLMARLNFLADVLVSYSNAFKKFFHPVLEEIADGCYSSANQFTIDGCLESFQRRLYSSADPKMRTEGFILKLQEE
LESLIVQVTRQFSIQRREVFPIISKNCNHEMQRQLLYTSMHVLPLGLLKCVILWFSAHLSEEESQSILQFLTLEDSSPQK
SFPRLLLQWLRFGYSGKTSVESFWKQLSVMFKIRCFCKKEPTEEASGSFSHQAQLQLCKETEADLFICPGKRNKSSTCFL
LPAAGDMYQTPYSSRMNQQMLFSGKLKPPPPLHLPEFFGEKNVDEPFMMDVKPIDLLFFFHKAMKADLDYLVSGSARLAT
DFRFLGEFQQRFHLIKFLYQIHSDAEDEIAFPALEAKGKLQNISHSFSIDHELEIKHFDKVSFILNEMLELNMFVSSAAD
HHRKMKYERLCLSLQEICKSMHKILSEHFQHEETELWGLFRDCFAIEEQEKIIGCMLGRISGEILQDMIPWLMDSLKSDE
QHVVMSLWRQATRKTMFVEWLTEWYNGHIVQEDAGEAHNDPFGDSDPLETVWKYLFEGASDGDRESIGGKLVELSDTDME
VDKPLGKTAPNNKEDKDQELPDTKKIRRGADKKEHKDQTDCNCHITMSQKANQFGQSNKYQHLLTMSQEEMAAMIRKISW
DSSLDPQKKSYLKQNLLMSRWIISQRIYNQEPSIVSRNTETIQGQHPSYRDPHSLVFGCKHYKRNCKLLAPCCDQLFTCI
RCHDEEADHSVDRKQIKKMMCMKCLLIQPIGANCSNILCKSSMGKYFCKICKLYDDERKIYHCPYCNLCRVGKGLGIDYF
HCMKCNACMARSLKEHVCREKCLEDNCPICHEYIFTSSSPVKALPCGHLMHSKCFKDYTCSHYTCPVCSKSLGDMQVYFS
MLDALLSEEKMPDEYTNKTQVILCNDCGRKGEVPYHWLYHKCSSCGSYNSRLL*

DNA
ATGGCAGACGGAGGTCATCTTCATCATCTCCCGCCGGAAAATGCTTCTGAGGTGGCTACCGTCGAAAACACCAAGCTTGC
GGATGCTCCGGTTCTGTTCTTCGTTTACTTCCACAAGGCTTTCCGTGCTCAGCTGGTGGAGCTCCGTCGTTTAGCTACAG
ACGCCGCTGAAGCCGGTTCGTTTAGCGGCGACCTCGCCGGTGAGCTATGCCGGAAGTTTGAGTTCTTGAAACTTGTCTAC
AAGTATCACAGCGCAGCTGAAGATGAGGTTATTTTTTTGGCGCTTGATTCACGTGTGAAGAACATTGTTTCTAACTATTC
GCTAGAGCATGATGGCACAGATGATCTCTTCACCTCAATTTTCCATTGGCTAAATGTTCTTGAACATGAGTTAGGGAACA
TATCTGATGTACTCCGTGAAGTTATGCTATGCATAGGCACCATTCAGTCATCCGTATGTCAGCATATGCTTAAAGAAGAG
CGGCAGGTCTTTCCTTTGTTAATTGAGAAGTTCACTTTCCAAGAACAAGCATCACTTGTATGGCAATTCATTTGTAGTGT
TCCAGTGATGGTGTTGGAAGACTTCTTGCCATGGATGATGTCTTATCTCTCTCACAAGGAGAGAACTGAAGTTGTGAACT
GCATGAAAGATGTTGTCCCAACTGAAGACTCATCACAACAGATAAAAGACTTTCTCAAGGTCATAAGCTCTTGGCTGATG
GATTGTGAGGCTTCTACAAAGATCTTGAAACAAGTAGAGTATGAAGATGTGTCTAAAGATACCAAGAACTTATCTCGGAG
TGGATGTTTTCAACGGCTTTGGCAGTGGAGTAAAAAGCCAGTTTTTATTCCAAATGTAGGACACAGCCCTATCCATGGTC
TTCAGATTTTTCAAAATGCAGTTGAAAAAGATTTGAGAGACATTCAAGAAGGATTGTGCCAAGCGAGCTTCCCAAGCCTT
CTTCTGGACCTTGATGTCCTCATGGCTCGGCTTAATTTTCTTGCTGATGTTCTTGTTTCTTATAGCAATGCATTTAAGAA
GTTCTTTCACCCGGTGTTGGAAGAAATAGCAGATGGATGCTATTCAAGTGCCAATCAGTTCACCATAGATGGATGTCTTG
AGAGTTTTCAGAGACGGTTATACTCAAGTGCTGATCCTAAGATGAGGACAGAAGGTTTTATACTGAAACTTCAGGAGGAA
CTTGAGTCTCTTATAGTTCAAGTAACAAGGCAATTTTCCATACAGAGAAGAGAGGTATTCCCAATCATCAGTAAGAACTG
TAACCATGAAATGCAGAGGCAGCTCCTGTACACAAGCATGCATGTCTTACCTCTTGGATTGCTAAAGTGTGTCATTCTCT
GGTTCTCAGCTCATCTATCAGAAGAGGAGTCTCAGTCAATTCTTCAGTTCTTAACATTGGAAGATTCTTCTCCTCAAAAA
TCATTTCCACGCCTCTTGTTGCAATGGCTACGCTTTGGCTACTCAGGCAAAACATCTGTTGAGAGTTTCTGGAAACAACT
GTCTGTAATGTTCAAAATAAGATGTTTCTGTAAAAAGGAACCCACTGAAGAAGCATCTGGATCCTTCTCCCATCAAGCAC
AGCTCCAACTATGCAAAGAAACTGAAGCTGATTTGTTTATATGTCCTGGGAAAAGAAACAAGTCTTCAACATGTTTCCTC
TTGCCAGCTGCTGGAGACATGTACCAGACACCTTACTCTAGTAGGATGAATCAGCAAATGCTATTCTCTGGAAAACTTAA
ACCTCCTCCTCCTCTCCATCTTCCAGAGTTTTTTGGTGAGAAGAATGTTGATGAGCCATTCATGATGGATGTTAAACCAA
TTGATCTTCTTTTCTTCTTCCACAAGGCAATGAAAGCAGATTTGGACTACCTTGTTAGCGGATCAGCTAGATTAGCAACT
GACTTTCGGTTCCTTGGGGAGTTTCAACAGAGATTCCATCTTATAAAGTTTCTTTATCAGATCCACTCTGATGCAGAGGA
TGAGATTGCTTTTCCAGCACTGGAGGCAAAGGGAAAGCTGCAGAATATTAGCCACTCATTCAGTATTGATCATGAGCTAG
AGATCAAGCACTTTGATAAAGTATCATTCATTTTGAATGAGATGTTAGAACTGAACATGTTTGTCTCAAGTGCAGCCGAC
CACCACAGAAAGATGAAGTATGAGCGGTTGTGTCTGAGTCTCCAGGAGATATGCAAATCCATGCACAAGATACTGTCAGA
GCATTTCCAACACGAAGAAACTGAGCTCTGGGGTCTGTTCAGGGACTGTTTTGCTATTGAAGAACAGGAGAAGATCATAG
GATGCATGCTTGGGAGAATAAGTGGGGAGATATTGCAGGATATGATTCCTTGGTTGATGGATTCCTTGAAATCTGATGAA
CAACATGTTGTAATGTCCTTGTGGCGACAAGCAACAAGGAAAACAATGTTTGTGGAGTGGCTAACAGAATGGTACAACGG
TCATATTGTACAAGAGGACGCAGGAGAAGCACACAATGATCCATTTGGGGATTCAGATCCACTGGAGACTGTTTGGAAGT
ATCTATTTGAAGGAGCTTCTGATGGGGACAGAGAGAGCATTGGTGGCAAACTTGTGGAGCTTTCAGATACAGACATGGAA
GTGGATAAGCCACTTGGAAAGACAGCTCCTAATAACAAAGAGGACAAAGATCAGGAACTTCCAGATACTAAAAAGATACG
TAGAGGAGCTGACAAAAAGGAGCACAAAGATCAAACTGACTGCAATTGTCATATCACAATGTCTCAGAAGGCTAACCAGT
TTGGTCAATCCAATAAATATCAACACTTGCTAACAATGAGTCAAGAAGAAATGGCTGCTATGATTAGAAAAATATCATGG
GACTCTTCCCTTGATCCTCAGAAGAAATCATACCTCAAGCAGAACTTGTTAATGAGCCGTTGGATTATTTCACAGCGGAT
ATATAATCAAGAACCATCTATTGTCTCAAGAAATACAGAAACAATTCAAGGTCAGCATCCATCTTATCGAGATCCTCACA
GTTTGGTCTTTGGCTGCAAGCACTACAAGAGGAACTGCAAGCTTCTTGCTCCTTGCTGTGACCAGCTCTTCACTTGTATA
CGTTGCCATGATGAAGAGGCTGATCACTCGGTTGATAGGAAACAAATCAAAAAGATGATGTGCATGAAATGCCTCCTGAT
TCAACCAATTGGTGCGAATTGTTCAAATATTCTGTGCAAGTCGTCAATGGGAAAGTACTTCTGCAAGATATGCAAATTAT
ATGACGATGAAAGGAAAATTTATCATTGTCCCTACTGTAATCTCTGCCGGGTAGGGAAAGGACTGGGCATTGACTACTTC
CATTGCATGAAATGCAATGCTTGTATGGCACGTTCCTTAAAAGAGCATGTTTGCAGAGAAAAATGCTTAGAAGATAATTG
TCCGATTTGCCATGAGTACATCTTCACCTCCAGCTCCCCGGTGAAGGCTCTTCCATGCGGTCACTTGATGCACTCTAAAT
GCTTTAAGGATTACACTTGTTCACATTACACATGTCCTGTCTGCAGCAAGTCTCTAGGAGATATGCAGGTCTACTTTAGT
ATGTTAGACGCATTGCTTTCAGAAGAAAAGATGCCTGATGAATACACCAACAAAACTCAGGTGATACTGTGTAATGACTG
TGGAAGAAAAGGAGAGGTTCCTTACCATTGGCTATACCACAAATGCTCATCTTGTGGCTCCTACAATTCAAGGCTCCTTT
AG