Details for Kale Locus Bo6g118950

Position : C6 ( 5`- 37189530 .. 37191743 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g118950

Protein [Map View]
MIRAKQISNLSSSARSFFLGGTRSSAADGNSCTSAEDDSCLLRRHQTRHEAAHTGNRVFTRPSPPPLHVSPPVLPVKPDP
ANHKIPLPDGTEVSRVDHTLPITSVKASGREHLGEVYTTSASKDPSERAPRNASPGTKQASNDVSHDLTKTTVSGKRKCG
YYPSGEMMRVTPAPRHVIEKVSSILRRFKWGLAAEEALHSSGFKMDAYQANQVLKQIDNYANALGFFYWLKTQPGFKHDE
HTYTTMVGNLGRAKQFGEIKNLLNEMVRDGCKPNTVTYNRLIHSYGRANYLKEAVNVFTQMQEAGCEPDRVTYCTLIDIH
AKAGFLDVAMDMYHRMQVAGLSPDTFTYSVIINCLGKAGHLPSAHRLFCEMVGQGCTPSLVTFNIMIALHAKARNYQSAL
KLYREMKAAGFRPDKVTYSIVMEVLGQCGFLEEAEGVFTEMERESWVPDEHVYGLLVDLWGKAGDVEKAWRWYQAMLHAG
VRPNVPTCNSLLSTLLRGHRLSEAYNLLQSMVALGLQSSLQTYTLLLSCCTEARSNFDLGFCGQLMAVSGHPAHMFLLKI
PPAGSDNGQKVRDHVSSFLDYMHSEDRESKRGLIDAVVNFLHKSGLKEEAGSVWEVAAVKNVYPDALREKSCSYWLINLH
VMSEGTAVTALSRTLAWFRKQMLVSGECPSRIDIVTGWGRRSRVTGSSMVRQAVEELLNVFNFPFFTENGNSGCFVGCGE
PLKNWLSESYVERMHLL*

DNA
ATGATTCGTGCAAAGCAGATCAGTAATCTTTCAAGTTCAGCAAGATCCTTCTTTCTTGGTGGAACAAGATCTAGTGCAGC
TGATGGAAACTCTTGCACATCCGCAGAAGATGATAGCTGCCTCTTGAGACGCCACCAAACTAGGCATGAAGCTGCACACA
CTGGGAACAGAGTTTTCACCCGACCATCACCTCCTCCTCTCCATGTTTCTCCTCCTGTTTTGCCTGTGAAACCGGATCCT
GCTAATCATAAGATCCCACTACCCGATGGAACTGAAGTCTCTAGGGTCGATCATACTCTTCCTATTACTAGTGTCAAAGC
CAGTGGAAGAGAGCATCTCGGTGAAGTCTACACTACCTCTGCTTCCAAAGATCCATCAGAGAGAGCTCCAAGAAACGCCT
CACCAGGCACTAAGCAAGCTTCAAATGATGTGTCTCATGATCTAACCAAAACTACCGTCTCTGGAAAGAGGAAGTGTGGC
TATTACCCCTCAGGGGAAATGATGAGAGTGACACCAGCACCTAGACACGTCATAGAAAAAGTTTCTAGCATATTGCGGAG
ATTCAAATGGGGCCTTGCTGCTGAAGAAGCTCTTCACAGTTCCGGTTTCAAGATGGACGCATACCAAGCAAACCAAGTCC
TCAAGCAGATAGATAACTACGCAAACGCTCTTGGTTTCTTCTACTGGCTCAAAACACAACCTGGTTTTAAGCACGATGAA
CACACTTACACCACTATGGTTGGTAACCTCGGCCGTGCAAAACAGTTCGGCGAGATAAAAAACCTTCTCAACGAGATGGT
TAGAGATGGATGTAAGCCAAACACCGTCACATACAACCGACTTATCCACAGCTACGGCCGTGCAAATTACCTCAAAGAAG
CCGTGAATGTCTTCACTCAAATGCAAGAGGCTGGATGCGAGCCTGACCGTGTGACGTACTGCACACTCATAGACATCCAC
GCTAAAGCTGGCTTTCTTGACGTTGCCATGGACATGTATCATAGAATGCAAGTGGCGGGGCTCTCTCCTGATACTTTCAC
TTACAGTGTGATAATAAACTGTCTTGGCAAAGCTGGTCATTTACCTTCTGCACATAGGCTCTTTTGTGAGATGGTTGGTC
AAGGCTGTACGCCTAGTTTGGTGACGTTCAACATCATGATAGCTTTGCACGCCAAGGCCAGGAACTACCAGAGCGCGTTG
AAGCTCTACCGAGAGATGAAAGCTGCTGGGTTTCGACCTGATAAAGTGACTTACAGTATAGTCATGGAGGTGCTTGGACA
GTGTGGGTTTCTTGAGGAGGCAGAGGGTGTATTCACTGAGATGGAACGTGAGAGCTGGGTTCCTGATGAACATGTGTACG
GTCTTCTTGTGGACTTGTGGGGGAAAGCTGGTGACGTGGAGAAAGCTTGGCGGTGGTATCAAGCAATGCTTCACGCTGGT
GTGAGACCTAATGTTCCTACTTGTAATTCCCTTCTCAGTACTTTGCTTAGAGGTCATAGGCTCTCTGAAGCTTATAATCT
ATTGCAAAGCATGGTGGCGCTTGGTCTGCAGTCTTCTTTGCAGACATACACATTGCTGTTGAGCTGTTGCACAGAAGCTC
GTTCAAACTTTGACTTGGGATTCTGCGGGCAGCTAATGGCGGTCTCAGGCCATCCTGCACACATGTTTCTCCTAAAAATT
CCGCCTGCAGGTTCAGATAATGGCCAAAAGGTGCGTGACCACGTCAGCAGCTTTCTTGATTACATGCACAGCGAGGACAG
AGAGAGCAAGAGGGGACTCATTGATGCAGTGGTGAATTTTCTCCACAAGTCAGGGCTTAAAGAAGAGGCGGGTTCGGTGT
GGGAAGTGGCTGCAGTCAAGAATGTGTATCCAGATGCATTGAGGGAGAAAAGCTGCAGCTATTGGCTTATAAATCTCCAT
GTGATGTCAGAAGGAACTGCTGTGACGGCACTGTCTAGGACGCTTGCGTGGTTTCGTAAGCAGATGTTGGTTTCAGGAGA
GTGTCCTTCACGGATTGATATAGTAACTGGTTGGGGAAGACGGAGTAGAGTCACAGGCAGTTCAATGGTGAGACAAGCAG
TTGAGGAGCTGCTCAACGTCTTCAACTTCCCGTTTTTCACTGAGAATGGTAACTCAGGCTGTTTTGTTGGATGCGGAGAG
CCTCTCAAGAATTGGTTAAGTGAATCATATGTTGAGAGGATGCATTTGCTTTAG