Details for Kale Locus Bo6g118920

Position : C6 ( 5`- 37176368 .. 37180940 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g118920

Protein [Map View]
MASLQLSSHFLGTNTTKHNSISISHNYSQTPFTRLFSRKKFMSCSMSMNGCEGDFKTPLGTIETRTMAAVLSPTAATERL
ISAVSELKSQPPPFSSGVVRIQVPIDQQIGAIDWLQSQNEIHLRCFFSRRSDVGRPDLLLDLASDNGNGRGSSDRELVSV
AGIGSAVFFRDLDPFSHDDWRSIRRFLSSSSPLIRAYGGMRFDPNGKISVEWEPFGAFYFAVPQVEFNEFGGSSMLAATL
AWDDELSWTLEDAIEALEETMLQVSSVVMRLRRESLGVSVLSKNHVPTKGAYYPAVEKALEIIKQKSSSLSKVVLARNSR
IITDTDIDPIAWLAQLQSEGHDAYQFCLQPPGAPAFIGNTPERLFQRNQLGVCSEALAATRPRSASTARDMEIERDLLTS
PKDDLEFSIVRENIREKLNSICDKVVVKPQKTVRKLARVQHLYSQLAGRLRREDDEFDILAALHPTPAVCGLPAEEARLL
IKEIESFDRGMYAGPIGFFGGKESEFAVGIRSALVEKGLGALIYAGTGIVAGSNPTSEWNELDLKISQFTKSIEYEATTT
TLQTIN*

DNA
ATGGCCTCACTTCAACTTTCTTCTCATTTTCTGGGCACAAACACTACAAAACACAACTCCATTTCCATCTCTCATAACTA
TTCCCAAACCCCATTCACCAGATTATTCTCCCGCAAGAAGTTTATGTCGTGTTCCATGTCTATGAATGGATGCGAGGGCG
ATTTCAAGACGCCACTTGGTACAATCGAGACAAGAACTATGGCGGCTGTTTTATCTCCGACAGCAGCCACTGAGAGACTA
ATCTCCGCCGTCTCTGAGCTAAAATCTCAACCTCCGCCGTTTTCCTCCGGCGTTGTCCGGATACAGGTGCCAATTGACCA
GCAAATCGGAGCAATCGATTGGCTTCAATCCCAGAACGAGATCCACCTTCGCTGCTTCTTCTCTCGCCGCAGCGACGTTG
GTCGTCCCGATCTTCTCCTCGACTTGGCCAGCGATAACGGTAACGGAAGAGGCTCATCGGATCGTGAACTGGTTAGCGTC
GCCGGAATCGGATCCGCAGTGTTCTTCCGTGACCTAGATCCCTTCTCTCATGATGACTGGAGATCCATCCGAAGGTTTCT
GTCGTCTTCGTCGCCTCTGATCCGCGCCTATGGAGGCATGCGGTTTGATCCCAACGGCAAGATCTCTGTGGAATGGGAAC
CCTTTGGTGCATTTTACTTTGCAGTGCCTCAGGTTGAGTTTAATGAGTTTGGGGGAAGCTCGATGTTGGCTGCAACTCTT
GCTTGGGATGATGAGCTCTCTTGGACGCTGGAGGATGCTATTGAAGCACTTGAAGAGACTATGCTTCAGGTTTCTTCTGT
TGTGATGAGGTTACGAAGGGAGTCTCTAGGAGTATCTGTTCTTAGCAAGAACCATGTTCCTACCAAAGGAGCGTATTACC
CTGCTGTAGAGAAGGCTTTGGAGATTATTAAGCAAAAGAGTTCATCGCTTAGCAAGGTTGTGCTTGCTCGCAACAGCAGG
ATTATAACGGATACTGACATTGATCCCATCGCTTGGCTTGCTCAGTTACAGAGTGAAGGGCATGATGCTTATCAGTTCTG
TCTGCAACCACCTGGTGCACCAGCTTTTATCGGCAACACGCCTGAGAGACTTTTCCAAAGGAATCAGTTAGGTGTCTGCA
GTGAAGCTCTGGCTGCAACTAGGCCTCGATCTGCTTCAACGGCACGTGATATGGAGATAGAGCGTGACTTACTAACAAGC
CCCAAAGACGACCTTGAGTTCTCTATTGTAAGAGAGAATATAAGAGAAAAGTTAAACTCTATATGTGACAAGGTGGTTGT
TAAGCCCCAAAAAACTGTGAGGAAGCTTGCAAGAGTGCAGCATCTATATTCTCAATTGGCAGGGAGGCTCAGGAGAGAAG
ATGACGAGTTTGACATCTTGGCTGCTCTGCATCCAACTCCAGCTGTTTGTGGGCTTCCAGCTGAAGAAGCCAGGCTTTTG
ATTAAGGAAATAGAATCTTTCGATAGAGGAATGTACGCTGGACCTATTGGATTTTTTGGTGGTAAAGAGAGTGAGTTTGC
AGTTGGGATCAGATCAGCTCTAGTCGAAAAGGGTCTTGGAGCATTGATTTATGCTGGGACAGGGATAGTAGCAGGAAGCA
ACCCAACCTCAGAGTGGAATGAACTTGATCTAAAGATATCTCAGTTCACCAAGTCAATCGAGTATGAGGCAACAACAACA
ACGCTGCAGACAATTAATTGA