Details for Kale Locus Bo6g108890

Position : C6 ( 5`- 34090114 .. 34091118 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g108890

Protein [Map View]
MFLLRSQKLWTVLVILAIGSRVTHSLHFDLHSGRTKCIAEDIKSNSMTVGKYSVDNPHDGHDLPQSHKISVKVTSSSGNA
YHHADQVASGQFAFSAVEAGDYMACFSAVDHKPEVTLSIDFEWRTGVQSKSWATVAKKSQVETMEFDVKSLLDTVNSIHE
EMFYLREREEQMQDLNRSTNTKMAWLSLLSLFVCIGVAAMQYVHLKTFFEKKKVI*

DNA
ATGTTTCTTCTCCGGTCGCAGAAGCTATGGACGGTGCTTGTGATTCTAGCGATTGGTTCGCGTGTAACACACTCGCTGCA
CTTCGATCTGCACTCGGGTCGGACAAAGTGTATAGCGGAAGACATCAAGAGCAATTCAATGACCGTCGGAAAGTACAGCG
TCGATAACCCTCACGACGGCCACGATTTGCCTCAATCCCACAAGATCTCCGTCAAGGTAACGTCAAGCTCCGGGAACGCG
TACCATCACGCGGATCAAGTGGCGTCTGGGCAATTCGCGTTCTCGGCAGTGGAAGCAGGGGACTACATGGCGTGTTTCTC
CGCCGTCGATCATAAGCCTGAGGTGACTCTGAGCATTGATTTTGAGTGGAGGACGGGTGTTCAATCCAAGAGCTGGGCTA
CTGTTGCCAAGAAGAGCCAAGTCGAAACCATGGAGTTTGATGTAAAGAGCCTTCTTGATACTGTCAACTCAATTCACGAA
GAAATGTTTTATCTTAGAGAAAGGGAAGAGCAAATGCAAGATCTGAACCGGTCCACAAACACTAAAATGGCGTGGCTGAG
TTTACTCTCTTTATTCGTCTGCATAGGAGTGGCAGCAATGCAGTATGTACACTTGAAGACCTTTTTCGAGAAGAAGAAAG
TCATCTAA