Details for Kale Locus Bo6g108830

Position : C6 ( 5`- 34049610 .. 34050606 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g108830

Protein [Map View]
MSDEEHHFESSDAGASKTYPQQAGNIRKGGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTSKKLEDIVPSSHNC
DVPHVNRVDYQLIDISEDGFVSLLTDNGSTKDDLKLPTDEALLTQLKSGFEEGKDIVVSVMSAMGEEQMCALKEVAPK*

DNA
ATGTCGGACGAGGAGCATCACTTCGAGTCAAGCGACGCAGGAGCTTCAAAGACGTATCCTCAGCAAGCTGGTAACATCCG
TAAGGGTGGTTACATCGTCATCAAGGGCCGTCCCTGCAAGGTGGTTGAGGTTTCCACTTCCAAGACTGGAAAGCACGGTC
ACGCCAAGTGTCACTTTGTTGCTATCGATATTTTCACTTCTAAGAAGCTCGAAGATATTGTTCCTTCTTCCCACAATTGT
GATGTTCCACATGTGAACCGTGTTGACTATCAGTTGATTGATATCTCTGAAGATGGCTTTGTCAGCCTTCTTACTGACAA
TGGTAGCACTAAGGATGATCTCAAGCTCCCAACTGATGAAGCTCTCCTCACACAGCTCAAGTCTGGATTTGAAGAGGGAA
AGGATATAGTTGTGTCTGTCATGTCTGCAATGGGAGAGGAGCAGATGTGTGCCCTGAAGGAAGTTGCTCCCAAGTAA