Details for Kale Locus Bo6g108790

Position : C6 ( 5`- 34028452 .. 34031157 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g108790

Protein [Map View]
MVHRESFLSSMRDLSQDSNTCSRSGDNKNLQYNQNGFSMRAPPPEEAYLGHERDFLKQTMLQHEAVFKNQVHELHRLYRT
QKSLMDEVKGNNNQSERTPESAIKRDLPEFLLGKPVCGGGEGSSSQACNNAPIANGVSSKDDDEVRPVKVRRRMIDLQLP
PDEYLDDADCPQEVGRGNNASHLNGSSSVMKNPNGLTDLNEPVQCQESSVHGLSSRDVYSLYGKNIVHAQRQWLETNTSQ
NGWMVLEAGRGKGIPRENLCVPSQPVQVLANHAFGYPPSTDQRRLLSGEWEARQRNPEVSYDSYVESSVASNAPSLTNGG
YRPEPSRTWSHWISNRSNGSVQKPLPFQTNPFLSYSAQGRAADSSSEMRGRGGFEGVYQGFSSASKETAFSVPPSNLNHL
NNGRNVTNGSLKHQSFESLQGPKRQECSAGLPWLKPKPLNQNGLTNGGFDLNASADGSSNASPHNGLGRAEMASSLSNGK
ILGYSISQKRSIWECNSSLTPSSVSLKEANTLVNRNFDINLPCDASVAEDVESKKAATNRNYIDLNICANEDESSGLCSK
PRMETRATPLIDLEAPPALESEEEGERTPEKRDEAGETLDELIKGAAEAIVTISLSHNPDEAASSTTDAAAKDPLSWFVN
TIASCGSDLEKRLDACLEACREECSSGEFDYFEAMTLNLPLTKEEDYMPTPLVPEHLKFDGTDSVGINRPRRGQARRGRP
RRDFQRDVLPGLASLSRLEVTEDLQMFEGLMKATGCSWNSGVARRSSNRGGSSRGRKRMISNVNGAPVCSSLEGPIDNSN
VQMVGLEDRSLTGWGNATRRPRRQRCPAGSTPPTVVLT*

DNA
ATGGTTCACCGTGAAAGCTTCTTGTCTTCAATGAGGGATCTCAGCCAAGATTCAAACACTTGCAGCCGGTCGGGAGATAA
TAAAAATCTGCAATATAATCAGAATGGTTTCTCGATGAGAGCTCCTCCCCCAGAGGAAGCTTACTTGGGACACGAGAGAG
ATTTTCTGAAGCAAACCATGCTTCAACACGAAGCCGTTTTCAAGAATCAGGTTCATGAACTTCACCGTTTGTATAGAACG
CAAAAGAGCTTGATGGATGAAGTTAAAGGAAACAACAACCAGTCTGAACGCACACCGGAGAGTGCCATCAAACGCGACCT
GCCTGAGTTTCTTTTGGGAAAACCGGTGTGTGGTGGTGGTGAAGGAAGCAGCTCCCAAGCTTGCAACAACGCTCCTATAG
CGAATGGTGTTAGCTCAAAGGACGACGATGAGGTTAGGCCTGTGAAGGTCAGGAGAAGAATGATTGATCTTCAACTCCCG
CCGGATGAGTATCTTGACGATGCAGATTGTCCTCAAGAAGTTGGAAGAGGCAACAATGCTTCTCATCTGAACGGTTCTTC
TTCGGTTATGAAGAACCCAAATGGGTTAACTGACTTGAACGAGCCTGTCCAGTGCCAAGAATCATCAGTTCACGGTCTTT
CTTCCAGGGATGTATACTCTCTTTATGGAAAAAACATTGTACATGCGCAACGCCAGTGGTTGGAAACGAATACTAGTCAA
AACGGATGGATGGTTCTAGAAGCAGGGCGTGGAAAAGGCATTCCAAGAGAGAACTTATGTGTGCCTTCACAGCCAGTACA
AGTTCTTGCTAACCATGCATTTGGCTATCCTCCTTCAACTGATCAGAGGAGGTTGTTATCCGGCGAATGGGAAGCTCGTC
AAAGGAATCCTGAAGTTTCCTATGATAGCTATGTGGAATCAAGTGTGGCATCAAATGCTCCAAGCTTGACTAATGGTGGC
TACCGCCCTGAACCTAGCAGAACTTGGAGCCATTGGATTTCAAACCGGAGTAACGGCTCAGTTCAGAAACCTTTGCCGTT
TCAAACGAATCCGTTCTTGAGTTATAGTGCACAAGGAAGAGCAGCAGATTCAAGTTCTGAGATGAGAGGACGTGGCGGCT
TTGAAGGGGTTTACCAAGGGTTCTCTTCAGCGTCGAAGGAAACTGCGTTTAGTGTACCACCGAGTAACCTTAACCATCTT
AACAATGGCCGGAATGTTACAAATGGTTCTTTGAAGCATCAGAGTTTTGAAAGTCTTCAAGGACCAAAAAGACAGGAATG
CTCTGCTGGGTTGCCCTGGTTAAAACCTAAGCCCCTTAACCAAAACGGACTAACCAATGGCGGTTTTGATCTGAATGCTT
CTGCTGATGGCTCGAGTAATGCATCTCCTCACAACGGTTTGGGACGGGCTGAAATGGCCAGTTCACTGAGTAATGGAAAG
ATTCTTGGATACTCAATCTCTCAGAAGCGTTCTATTTGGGAGTGCAACTCTTCCCTTACCCCTTCTTCTGTGTCTCTCAA
GGAAGCAAACACTTTGGTGAATAGAAACTTCGACATCAACTTGCCATGTGACGCCTCGGTTGCTGAAGATGTTGAAAGTA
AAAAAGCTGCCACTAACAGGAACTACATTGACTTGAATATATGTGCTAACGAGGATGAAAGTTCCGGCTTGTGTTCCAAA
CCAAGAATGGAAACAAGAGCAACTCCTTTAATAGATTTGGAAGCTCCCCCGGCTCTTGAGAGTGAAGAAGAAGGGGAGAG
AACGCCAGAGAAGAGAGATGAAGCTGGAGAGACTCTTGATGAACTCATCAAGGGAGCAGCAGAAGCTATAGTCACCATCT
CACTGTCTCATAATCCTGATGAAGCTGCTTCCTCTACGACTGATGCGGCTGCTAAAGACCCGCTCTCTTGGTTTGTGAAC
ACAATAGCTTCTTGTGGCAGTGATTTAGAAAAGAGGCTTGATGCTTGTTTAGAAGCCTGCCGTGAGGAGTGTTCTTCAGG
GGAGTTTGATTACTTCGAGGCAATGACTCTGAACTTACCTCTAACCAAAGAAGAAGACTACATGCCAACGCCTTTAGTCC
CTGAACATCTGAAATTTGACGGGACGGATTCTGTAGGCATCAACAGGCCAAGGAGAGGACAAGCAAGACGAGGAAGACCA
AGAAGGGATTTCCAAAGGGATGTTCTCCCTGGACTTGCTTCTCTGTCTAGGCTCGAAGTAACCGAAGATCTTCAAATGTT
TGAGGGACTTATGAAAGCCACAGGCTGCAGCTGGAACTCAGGAGTGGCTAGAAGAAGCTCAAACCGAGGTGGGTCTAGCC
GAGGAAGGAAACGAATGATCAGCAACGTCAACGGAGCTCCGGTTTGTTCTTCTTTGGAGGGGCCAATAGATAACAGTAAT
GTACAAATGGTGGGACTTGAAGATAGGAGCCTTACCGGGTGGGGAAACGCAACCAGAAGACCAAGGAGACAAAGATGCCC
TGCAGGTAGTACTCCACCAACTGTGGTCTTAACATAA