Details for Kale Locus Bo6g108740

Position : C6 ( 5`- 33996035 .. 33997559 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g108740

Protein [Map View]
MSVLLPLCLVLSMITYSNAAYCVCKDGNEQVLQKAIDYACGAGADCSQIQQNGACFQPNTVKNHCDVAVNSYYQKKASSG
ATCDFNGAAVISSSPPSTASSCLTGSSSSGTPSTGTPTTGTPSTGTPTTGTPSTGTPTTGTPSTGTPTTGTPSTGTPTTG
TPTSGFPSTGTPSTGMPNSGTPANGMPTSSSSSVFPGTTLGPTGSGGFGDPNAGEKISVRTNTAFFLLTGLAIMLVV*

DNA
ATGTCGGTTTTACTTCCTCTGTGTCTGGTTCTCTCCATGATTACCTATTCAAATGCTGCGTATTGTGTATGCAAAGACGG
GAACGAGCAAGTGCTTCAGAAAGCCATAGACTACGCATGTGGAGCAGGAGCTGACTGCTCTCAGATCCAGCAGAACGGAG
CTTGTTTCCAGCCTAACACCGTCAAAAACCACTGCGACGTCGCCGTCAACAGTTACTACCAGAAGAAAGCTTCCTCCGGT
GCCACCTGTGACTTTAACGGCGCCGCCGTTATCTCTAGCTCCCCTCCGTCAACTGCTTCAAGCTGTTTAACTGGTTCCAG
CTCTAGTGGGACCCCGTCCACTGGGACTCCCACCACAGGAACCCCAAGCACTGGAACACCAACCACAGGAACCCCAAGCA
CTGGGACACCAACCACAGGAACCCCAAGCACTGGGACACCAACCACCGGGACCCCAAGCACTGGGACACCAACCACCGGG
ACTCCAACCAGTGGCTTCCCATCCACCGGGACTCCTTCCACTGGGATGCCAAATTCCGGCACGCCAGCAAACGGAATGCC
AACTTCGTCTTCATCTTCTGTGTTCCCTGGCACTACTCTTGGACCGACCGGGAGCGGCGGATTCGGCGATCCGAACGCTG
GAGAGAAGATCTCAGTCCGAACTAACACTGCCTTCTTCTTACTAACCGGTTTAGCTATTATGCTTGTGGTTTAA