Details for Kale Locus Bo6g072230

Position : C6 ( 5`- 20518571 .. 20520135 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g072230

Protein [Map View]
MEFLIIILFIVSLPIFIFFIFPRQPSSHIGFKSYPIVGSIPGLVKNRHRFLDWTVETLSRCPTQTAVFRRPGNQQFVMTA
NPANVEFMLKTKFDSFPKGERFISFLEDFLGRGIFNSDGEMWWKQRKTASYEFSTRSLRDFVMTNVTVEINTRLVPVLAA
AATAGKPIDLQDILEGFAFDNICKLAFNVDAACLGDDGAHGVQFMRAFETAATIISKRFQSVVSYSWKIKKKLDIGSEKV
LRESIVTVHKFADDIVRHRTDDQARSSNTNEDLLSRFINIEEMSSPELLRDIVISFILAGRDTTSSALSWFFWLLSKHPE
VEDKIRQELNSIRARTGKRVGEVYGFEELKLMNYLHAAITESLRLYPPVPVDTMSSVEDNVLPDGTFVGKAWGISYNAYA
MGRMESIWGKGCDRFDPERWIDETNGGFRGENPYKFPVFHAGPRMCLGKEMAYIQMKSIVAAVLDRFVVEVRVKERPEIL
LSMTLRMKGGLFARIHERT*

DNA
ATGGAGTTTCTCATCATCATCCTCTTCATTGTCTCTCTCCCTATCTTCATCTTCTTCATCTTCCCAAGGCAACCGTCCTC
ACACATCGGTTTCAAATCCTACCCGATCGTCGGCAGCATACCTGGACTGGTGAAAAACCGTCACCGTTTCCTCGATTGGA
CGGTAGAGACTCTGTCTCGATGCCCGACACAAACAGCTGTTTTCCGGCGACCAGGGAACCAACAGTTCGTCATGACGGCA
AATCCAGCAAACGTCGAGTTCATGCTCAAGACGAAGTTCGATAGCTTCCCTAAAGGCGAGCGGTTCATCTCGTTTCTTGA
AGATTTTCTTGGCCGTGGAATATTTAACTCCGACGGCGAGATGTGGTGGAAACAGAGGAAGACGGCGAGCTACGAGTTCA
GTACTAGGTCTCTCCGTGACTTCGTTATGACCAACGTCACTGTTGAAATCAACACCAGGCTTGTTCCGGTGTTAGCCGCC
GCGGCGACCGCTGGGAAACCGATAGACCTACAAGATATATTGGAAGGCTTTGCGTTTGATAATATCTGCAAGTTAGCATT
CAACGTCGATGCCGCTTGCCTCGGCGACGACGGAGCACACGGTGTACAGTTCATGAGGGCCTTCGAGACGGCGGCGACGA
TCATCTCGAAACGGTTTCAGTCCGTTGTCTCGTATTCATGGAAGATAAAGAAGAAACTTGACATAGGATCAGAGAAGGTT
CTGAGAGAATCAATCGTGACCGTCCATAAATTCGCAGACGATATCGTGCGTCACAGGACTGATGATCAAGCTAGGTCAAG
TAACACGAACGAGGATTTGCTTTCAAGATTCATCAACATCGAGGAGATGAGTTCGCCGGAGCTGCTTCGTGATATTGTCA
TTAGTTTCATTCTCGCGGGACGAGACACGACATCGTCTGCTTTGAGCTGGTTCTTCTGGTTACTCTCTAAGCATCCAGAA
GTGGAAGACAAGATCAGACAAGAGCTGAACTCGATCAGGGCACGAACAGGGAAGCGTGTCGGAGAAGTTTACGGGTTTGA
GGAGCTTAAACTGATGAACTATCTGCACGCAGCGATAACCGAATCTCTTAGGCTATATCCTCCTGTACCAGTTGACACAA
TGAGTAGTGTTGAGGACAATGTATTGCCTGATGGAACATTTGTAGGGAAAGCTTGGGGAATAAGTTACAACGCGTACGCG
ATGGGGAGGATGGAGAGTATTTGGGGGAAGGGTTGTGATAGGTTTGATCCAGAGAGGTGGATTGATGAAACAAATGGTGG
GTTTAGAGGTGAAAATCCTTACAAGTTTCCGGTGTTTCATGCAGGACCAAGGATGTGTTTAGGTAAGGAGATGGCTTATA
TTCAGATGAAGTCGATAGTTGCTGCGGTGTTGGACAGGTTTGTTGTTGAGGTTCGAGTGAAGGAGCGTCCTGAGATTCTC
TTGTCTATGACACTTAGAATGAAAGGTGGATTGTTTGCTAGGATACATGAAAGAACCTGA