Details for Kale Locus Bo6g072200

Position : C6 ( 5`- 20488264 .. 20489955 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g072200

Protein [Map View]
MADNKDLDSNPPAEDLTIRPLKKIEIAHESESEPELKKQKLKELQRKAYYSVLHASKAENSALSHKKSQIIQRLMKEWKI
DQETHVSVAEKIDNSEKNVSSSLNSVPESLVVKRIRARLHDEDCLPSNKKMKLEELHKQAYEDVLNAFNAESPTLSSVNP
LLKSYANDSVSTRRKGCVHVLSSFSQGFYPAGCRFLPSDDMMANYYLKNKVLGQPMNARIIPGECPHIFSIPPRDLPGYP
IETEWHCYCRKPNGQDPRSLWTRVGEDTTVFGPQGNGVGIKRTYALTDQEKESDDISLPGEIEPPREEWFIEEISLPPSV
ADTDLVFCHVILNKIEKEEEYEEEEEYDDDEEEE*

DNA
ATGGCGGACAATAAAGATTTAGACTCAAATCCTCCCGCAGAAGATCTAACGATTCGCCCATTAAAGAAGATAGAAATAGC
ACACGAGTCCGAGTCTGAGCCCGAGCTCAAGAAACAGAAACTCAAAGAGCTCCAGAGAAAAGCTTATTACTCTGTTCTCC
ATGCTTCCAAAGCAGAAAACTCGGCGTTATCACACAAGAAGTCTCAGATCATACAAAGGTTGATGAAGGAGTGGAAGATT
GATCAAGAAACTCACGTCTCTGTTGCAGAAAAGATTGATAACTCTGAAAAAAATGTATCTTCGAGTCTCAACTCTGTTCC
AGAGTCTCTTGTTGTGAAACGTATCCGTGCAAGATTGCATGATGAAGATTGTCTCCCAAGTAACAAAAAGATGAAACTCG
AGGAGCTCCATAAACAGGCTTACGAAGATGTTCTCAACGCCTTTAACGCAGAGTCTCCAACACTATCCAGCGTAAACCCT
CTTTTAAAATCTTATGCCAATGATTCTGTTAGTACTCGAAGGAAAGGTTGTGTTCATGTCTTGTCTTCTTTCAGTCAAGG
GTTTTACCCTGCCGGCTGCAGATTTCTTCCATCAGATGATATGATGGCAAACTATTATCTGAAGAACAAAGTTCTAGGGC
AGCCAATGAACGCACGTATCATACCTGGAGAATGTCCCCACATCTTCTCAATACCTCCTCGTGATTTGCCTGGCTATCCA
ATAGAAACAGAATGGCATTGCTATTGCAGGAAACCTAACGGCCAAGACCCTCGGAGTCTCTGGACACGAGTGGGTGAAGA
TACTACTGTGTTTGGTCCACAGGGAAACGGTGTTGGTATCAAACGTACATATGCTCTCACTGATCAGGAAAAAGAATCTG
ATGACATTTCTTTGCCTGGCGAGATAGAACCTCCAAGGGAAGAGTGGTTCATTGAAGAAATTAGTCTCCCACCGTCTGTT
GCTGATACTGACTTGGTTTTCTGCCATGTTATTCTCAACAAGATTGAGAAAGAAGAAGAATATGAAGAGGAAGAAGAATA
TGATGATGATGAGGAAGAAGAATAG