Details for Kale Locus Bo6g071150

Position : C6 ( 5`- 20448931 .. 20451257 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g071150

Protein [Map View]
MTKVCPETEERTLQEPVLTVSTDVSFASNHFPTYKLGPDNEIVDEPKEDEKGPSVKETVEEESQLLSDQHKRLSVRDLAS
KFDKKLAAAVSLADEAKLKEVASLEGHVMLKKLRDALEYMRGRTDGQNKKDVEKAISMVEALAVKLTQNEGELIQEKFEV
KKLGNFLKQASEDAKKLVNHEKSFACAEIESARAVVLRLGEAFEEQKRSSEASRAQGPDVEKLAEEVQEARQIKRMHHPT
KVMGMQHELHGLRSRIQEKYMNSVRLHQEIATIKRAEESISCPFVLEGTQSLGSCLKIHVSAPDNAIDLSNCSIQWYRAA
CETSRREAISGSNQAVYAPEPFDVGRILQADILSNGQKVTVTTDGPIDPDAGLQSRIESLMKKSNSDFSVVISQMNGQDY
ASRSHVLTIGKTRIKLSRGWITKAREIYSTSMQLCGVRGNIKAPAKALFWQPRKSLTFTLTFESEQERNTAIALARKYAF
DCNVTLLGPDD*

DNA
ATGACGAAAGTGTGTCCTGAAACCGAAGAAAGAACATTACAAGAGCCAGTTCTTACAGTATCAACAGATGTGAGCTTTGC
TTCTAACCATTTCCCAACGTACAAGTTAGGACCTGATAATGAGATAGTAGATGAACCTAAAGAAGATGAGAAAGGTCCAT
CAGTGAAAGAAACCGTCGAGGAAGAGAGCCAGCTCTTGTCTGATCAGCACAAGCGTCTTTCAGTGCGTGACCTCGCTAGT
AAATTTGACAAGAAGTTGGCTGCAGCTGTTAGTTTGGCTGATGAGGCAAAGCTAAAAGAGGTGGCTTCTTTAGAGGGACA
TGTAATGCTGAAGAAGCTAAGAGATGCTTTAGAATACATGAGAGGACGCACGGATGGGCAGAACAAGAAAGATGTGGAGA
AAGCTATCTCCATGGTTGAAGCTCTAGCTGTGAAGTTAACTCAGAATGAAGGTGAACTAATTCAAGAAAAGTTTGAAGTG
AAGAAACTTGGAAACTTCCTCAAGCAGGCTTCAGAAGATGCAAAGAAACTAGTAAACCATGAAAAGTCATTTGCATGCGC
TGAGATCGAAAGTGCAAGAGCCGTTGTGCTTAGACTTGGAGAGGCATTTGAAGAACAGAAGCGAAGCTCTGAGGCTTCTA
GAGCTCAGGGACCGGATGTTGAGAAATTGGCTGAGGAGGTTCAGGAAGCTAGACAGATCAAACGCATGCATCACCCAACA
AAGGTGATGGGCATGCAACATGAGCTTCATGGTTTAAGAAGTCGAATTCAAGAGAAGTATATGAACTCTGTTAGACTTCA
TCAAGAGATAGCAACAATCAAAAGAGCAGAGGAATCCATTTCATGTCCATTTGTTCTAGAGGGCACGCAAAGTCTCGGCT
CTTGCTTAAAAATCCATGTTAGTGCTCCAGATAATGCCATAGATCTTTCCAACTGTTCCATCCAGTGGTACCGTGCAGCA
TGTGAAACTAGCAGAAGGGAAGCTATATCTGGTTCAAACCAAGCAGTATATGCTCCAGAACCATTTGATGTTGGGAGGAT
CTTACAGGCAGACATTCTTTCAAATGGACAGAAAGTCACAGTTACAACCGATGGTCCAATTGATCCTGATGCTGGCTTGC
AATCCCGAATAGAGTCTTTGATGAAAAAATCCAACAGTGATTTCAGCGTGGTTATATCACAGATGAATGGACAAGACTAT
GCATCTCGATCTCATGTACTTACTATTGGAAAAACGAGGATAAAGCTGTCTCGAGGATGGATCACAAAGGCGAGAGAAAT
ATATTCAACATCCATGCAGCTCTGTGGAGTTAGAGGCAATATTAAGGCTCCGGCCAAAGCGTTGTTCTGGCAACCAAGAA
AGAGTCTAACTTTCACACTAACCTTTGAGTCAGAACAAGAACGTAACACAGCCATAGCCCTTGCTCGGAAATACGCTTTT
GATTGCAATGTTACATTGCTTGGGCCAGATGATTAA