Details for Kale Locus Bo6g071140

Position : C6 ( 5`- 20446496 .. 20448085 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g071140

Protein [Map View]
MEALVCRKLGDPTAMEPGSTESPVEVSKTYPIPPLTSDTAVRVKVTATSLNFANYLQILGKYQEKPPLPFIPGSDYSGIV
DAIGPSVTKFSVGDRVCSFAALGSYAQFIVADQSLLFLVPEGCDMIAAAALPVAFGTSHVALVHRAGLTSGQVLMVLGAA
GGVGLAAVQIGKICGAIVIAVARGSEKVQLLKSMGVDHVVDLGSENVITSVKEFVKTRKLKGVDVLYDPVGGKLTKDSMK
VLNWGAQILVIGFASGEVPLIPANIALVKNWTVHGLYWGSYKIHQPNVLDDSIRELLSWLARGLITIHISHTYSLSQSNL
AFGAIKDRKAIGKVMIALDHKATLSSKL*

DNA
ATGGAGGCTTTGGTTTGCCGGAAACTAGGAGATCCGACGGCGATGGAACCAGGGAGTACAGAATCTCCGGTGGAAGTGAG
CAAAACCTACCCGATCCCGCCTCTGACCTCCGATACAGCGGTGAGAGTCAAGGTCACAGCAACGAGCTTGAACTTCGCGA
ATTACCTTCAGATTCTCGGAAAGTACCAGGAGAAACCTCCGTTGCCTTTCATCCCCGGCTCCGACTACTCCGGAATCGTC
GACGCCATCGGTCCATCCGTCACCAAATTCAGCGTCGGTGATCGAGTTTGCTCCTTCGCCGCCCTCGGTTCCTACGCTCA
GTTCATCGTCGCCGACCAGTCTCTCCTGTTCCTTGTACCGGAAGGATGCGACATGATCGCTGCAGCTGCACTTCCCGTTG
CGTTTGGGACTTCTCATGTTGCTCTTGTCCATAGAGCTGGTTTAACCTCTGGTCAGGTCTTGATGGTTCTTGGCGCTGCT
GGTGGCGTTGGTCTTGCAGCTGTTCAAATCGGGAAGATCTGTGGAGCCATTGTCATTGCAGTTGCTAGAGGGAGTGAGAA
GGTTCAGCTGTTGAAGTCAATGGGAGTGGATCATGTTGTTGATTTAGGCAGTGAGAATGTTATTACTAGCGTCAAAGAGT
TCGTCAAGACAAGAAAGCTGAAAGGAGTTGATGTTCTGTATGATCCTGTAGGAGGGAAACTCACCAAGGACTCCATGAAA
GTTCTCAACTGGGGAGCTCAGATTCTTGTGATTGGTTTCGCAAGCGGTGAAGTACCTCTGATTCCTGCTAATATAGCACT
TGTGAAGAACTGGACCGTTCATGGTCTATATTGGGGCAGCTACAAAATCCACCAACCCAATGTTCTCGATGATTCCATCA
GAGAGTTACTGTCATGGCTTGCTAGAGGATTGATCACCATTCACATCTCTCATACCTATAGTCTCTCCCAGTCCAATCTC
GCTTTTGGGGCCATCAAAGACAGGAAGGCAATTGGAAAAGTGATGATTGCTCTCGACCACAAGGCCACCCTCTCTTCAAA
ACTATAG