Details for Kale Locus Bo6g071120

Position : C6 ( 5`- 20439330 .. 20444032 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g071120

Protein [Map View]
MMKKKKHSRSQSSSKKTIEPSPDSSPSPSPRLLSIFRSKLVSGKDLKHMFRGMKTKTAPGLSSQSRIVRCPKCHKLLQEP
IDATIYKCSGCNSILQVFSVSCALSLHVAKRWDLESNGDSIPEALLYSQNRSLSTQLESAEAGSKTPMRSTHREYNSRAS
PSVERGYDSETVYKHETSDVHREWMRRADEFSVTGESDAFASARSSPYNSRSNASEWTHHERRYQVPFYPASPSPSSAYE
YGYNSPFHGSQASASEQSYYHHHQPNQFKQKEREGWFQESSAASPIRFPGETSNKNYYPSSSQYQLHDPRYHNLYSERSY
QAAKAPLRSTYSEHSKSGTSREKRSQRDKKKDVRKKKPVVKRYVLPSAGGAPFATCSYCLELLQLPQVSLHGKHKGYQVR
CGSCSGVLKFSVREKADTVLDSPGFAEETVTNHQDSASEGHEEIYPDDSHFTCSDNGSRDGICKSNDDVILRQNVETFED
NKSKEDTRRISSTLLDSKLEALQPFLNQKLREQQSASSESTGETSRKHLERSEEACSEKSTEMDNNISERVSCDLEEVGL
YEKNETLEPEVMFGDGSGESLEVPVYKKERMSDSSIEAERVADKPVSHSGETRVLSENTGDSQEFDWEETQEKEEYGGEG
KWEDSMGDKPVLILETSRYTGDSICDNSSSNGEAYEDTKIISAASQNENQRFIGQSGEDTVTTSRTHEEQSKYENLSERD
TTISDSVRYIVSEESRYDTGKVSEDGSAVSLTKASETFSTSIEGERGEERSASHQMDLLPNENVEDSYERLEYAGERTWE
EETMEDRAGLHLEEYESNYENYSKPFEWISEGASAFHNHRHEPKLGTINEPDEDADGRLKSSSRGSFSDHESSEASAVFQ
ESQDAQSKYEYEIPSERQELSNTERHEIQEEGRYEINETFGPTKMVEDGSVVSLEKTGETNIGERGEERSVSHHHMATEN
ENLEISYGTVEQVYLEGGGLQLEECHNNPHEWTSERAPTFRLHEYELGTMSASEEDANERSSSSTDSTNDNQAVAHEEPS
LMDENKFEELKVTLMVEDGPSLHLDKYGNDSTKLEDTFERTSERAPTFRLHEYELGTMLEPEEHPDGRSESSSTGSFNNH
ESSKLRDVFHEEEEEELQLHEMTEDRVALDLKKGENGTIKLEETFERAPTFRLHDSELGTRLEPDEDADGRSESSSRGTF
NDHVISKEREMNHEEEPRLVIDSRSKAQQEGEMAKDTVPLHLECENESMKLNETFKWTSERVLTFSHREHELGTMPEPDE
DASESSLRGTFNDHGVSKERSVSHKDEPWLVEDYETKALKASVIADSGPSLHLEKCENVVLNQTVGPRDNLFRLSHDDTL
EQERITFHLEKSQEKQVNLRQAFKQQGDTEDNIPASEGHESPCKMAEVDSEAEEDMLGDHLEHLQIENERSGLTSEPYSH
FYNTTDPSEIVGLRLALYETQTSPLSSPMHTPTGSPLHILMRSPIASPMHTHIVSPMRSPINSSGSLSDVLFFGKKA*

DNA
ATGATGAAGAAGAAGAAACACAGCAGATCCCAATCTTCTTCCAAGAAAACTATTGAACCATCCCCAGATTCTTCACCTTC
ACCTTCACCTAGGCTCCTCTCCATTTTCCGTTCTAAGTTGGTAAGTGGTAAAGACTTGAAGCATATGTTCAGAGGCATGA
AGACCAAAACTGCACCCGGACTGTCTTCTCAGTCTAGAATCGTGAGATGCCCCAAGTGCCACAAGCTTCTCCAAGAACCT
ATAGATGCCACTATTTACAAATGCAGTGGATGCAACTCCATTCTCCAAGTGTTCTCTGTTTCTTGTGCTCTTTCTTTACA
TGTAGCAAAACGTTGGGACCTGGAAAGCAATGGTGACTCTATTCCAGAGGCCCTCCTTTATTCCCAAAACCGTAGTTTAA
GTACACAGTTAGAATCTGCAGAAGCTGGTAGTAAAACACCAATGAGGAGCACTCACCGGGAGTACAACTCGAGGGCATCC
CCTTCTGTTGAAAGGGGTTATGATTCGGAAACTGTTTACAAGCATGAGACATCTGATGTCCACAGAGAATGGATGAGAAG
GGCTGATGAGTTCAGTGTGACCGGTGAGTCTGATGCGTTTGCTTCAGCAAGAAGCTCTCCTTATAACTCACGCAGCAATG
CCTCGGAGTGGACACATCATGAGAGGAGATATCAGGTTCCTTTCTATCCAGCTAGTCCTTCCCCTTCTTCTGCGTATGAG
TATGGCTACAATAGTCCCTTTCACGGGTCCCAAGCTTCTGCATCCGAGCAGTCTTATTATCATCATCATCAACCAAACCA
ATTCAAGCAAAAGGAGAGAGAAGGCTGGTTTCAAGAATCTTCTGCTGCTTCACCAATTCGTTTCCCTGGTGAGACATCTA
ATAAAAACTACTATCCCTCGTCTTCTCAGTATCAGCTTCATGATCCTCGGTATCATAATCTCTACTCTGAGCGTAGTTAT
CAAGCAGCTAAAGCGCCACTACGTTCCACATACTCTGAGCATTCCAAGAGTGGGACAAGCCGTGAGAAGAGATCTCAAAG
GGACAAAAAGAAGGATGTTAGAAAGAAGAAGCCGGTGGTGAAACGCTATGTGCTTCCTTCAGCGGGTGGAGCGCCTTTTG
CAACTTGTTCCTACTGCTTAGAACTTCTCCAGCTTCCTCAGGTGTCTCTCCATGGAAAACATAAGGGGTATCAAGTGCGA
TGTGGCAGTTGTTCCGGTGTACTTAAGTTCTCTGTTCGAGAGAAAGCAGATACTGTCCTTGATTCACCTGGTTTTGCTGA
GGAGACTGTTACTAATCATCAGGATTCAGCTTCAGAAGGTCACGAAGAGATCTATCCGGATGACAGTCATTTTACTTGTT
CAGACAACGGCTCCAGAGATGGAATCTGCAAAAGCAACGATGATGTGATCTTGAGACAGAATGTGGAAACGTTTGAGGAT
AATAAGAGTAAAGAAGACACAAGGAGAATATCAAGCACATTATTAGATTCGAAACTGGAGGCGTTACAGCCTTTCCTGAA
CCAGAAGTTGAGGGAACAACAATCTGCATCAAGTGAGAGTACCGGAGAAACTTCAAGAAAGCATCTAGAGCGATCTGAGG
AAGCTTGTTCAGAGAAGTCAACCGAGATGGATAACAACATTTCTGAAAGAGTCAGTTGTGATCTAGAGGAGGTTGGATTA
TATGAGAAGAATGAAACTCTTGAGCCAGAAGTGATGTTTGGAGATGGATCAGGCGAGTCCTTAGAGGTTCCAGTATACAA
GAAGGAAAGAATGAGTGATTCAAGTATAGAAGCTGAGAGAGTTGCAGATAAACCGGTTTCTCATAGTGGGGAAACACGTG
TACTGTCTGAGAATACCGGAGACAGTCAAGAGTTTGATTGGGAGGAGACTCAAGAGAAGGAAGAATATGGAGGTGAAGGT
AAATGGGAGGATAGCATGGGAGACAAACCGGTGTTGATTTTGGAGACATCTCGGTACACTGGAGATTCAATCTGTGACAA
CAGCTCAAGCAATGGTGAAGCATATGAAGATACAAAGATCATATCAGCTGCATCACAGAACGAGAACCAGAGGTTTATAG
GCCAATCAGGTGAGGATACAGTAACAACATCCAGGACTCATGAGGAGCAGTCCAAGTATGAGAACTTAAGTGAAAGAGAT
ACGACCATTAGTGACAGTGTCAGGTATATTGTGTCAGAGGAATCAAGATATGATACTGGCAAAGTGAGCGAAGATGGATC
AGCTGTTTCTCTCACGAAGGCGAGTGAGACGTTCAGCACAAGCATAGAAGGCGAGAGAGGTGAAGAGAGATCGGCATCTC
ATCAAATGGATCTTCTTCCAAACGAGAATGTAGAAGATTCCTATGAAAGACTCGAGTATGCAGGTGAAAGAACATGGGAA
GAAGAGACTATGGAAGATAGAGCGGGTTTGCATTTGGAGGAATATGAAAGCAACTATGAGAATTACAGCAAACCATTTGA
ATGGATTTCAGAAGGAGCTTCGGCATTTCATAATCACAGGCATGAGCCAAAGCTAGGGACGATAAATGAACCAGATGAGG
ATGCTGATGGAAGATTGAAATCCAGTTCAAGGGGTTCCTTCAGTGACCATGAAAGTTCAGAAGCGAGTGCTGTATTTCAG
GAATCTCAAGATGCTCAGTCCAAATATGAGTATGAGATACCAAGCGAAAGACAAGAGTTGAGCAACACAGAAAGGCATGA
GATACAGGAGGAGGGTAGATACGAGATAAATGAAACGTTTGGGCCAACCAAGATGGTGGAAGATGGATCTGTTGTTTCTC
TTGAGAAGACGGGCGAGACAAACATAGGCGAGAGAGGTGAAGAGAGGTCGGTATCTCATCATCACATGGCTACTGAAAAC
GAGAATCTGGAGATCTCTTACGGAACAGTAGAACAAGTTTATCTGGAAGGAGGCGGGTTGCAGTTGGAGGAATGTCATAA
CAATCCACATGAATGGACTTCAGAAAGAGCTCCAACATTTCGTCTGCATGAGTATGAGCTAGGGACAATGTCTGCATCGG
AAGAAGATGCGAATGAAAGATCATCCAGTTCAACAGATTCCACCAATGACAATCAAGCTGTGGCTCATGAGGAGCCTTCG
CTGATGGATGAGAACAAATTCGAAGAGCTAAAAGTTACTCTAATGGTGGAAGATGGGCCATCATTGCACTTGGACAAGTA
CGGAAATGATTCAACGAAACTGGAAGATACATTTGAACGGACTTCAGAAAGAGCTCCGACATTTCGTCTGCATGAGTATG
AGCTGGGGACAATGCTTGAACCAGAAGAGCATCCTGATGGAAGATCGGAATCCAGTTCAACTGGTTCCTTTAATAACCAT
GAAAGTTCAAAGTTGAGAGATGTCTTCCACGAGGAGGAGGAGGAGGAGCTACAACTACACGAAATGACAGAAGATAGGGT
GGCATTGGACTTGAAGAAGGGTGAAAACGGAACAATAAAATTGGAAGAGACATTTGAAAGAGCTCCAACGTTTCGTCTTC
ATGACTCTGAGCTAGGGACAAGGCTTGAACCAGACGAGGATGCTGATGGACGATCAGAATCTAGTTCAAGGGGTACCTTC
AACGACCATGTAATTTCAAAAGAAAGAGAGATGAATCATGAGGAGGAGCCCAGGCTGGTGATTGATAGCAGAAGCAAGGC
GCAACAAGAAGGCGAAATGGCAAAAGATACAGTACCTCTGCACTTGGAGTGCGAGAATGAATCAATGAAACTGAATGAGA
CATTTAAGTGGACTTCAGAGAGAGTTTTAACATTTAGTCACCGTGAGCATGAGCTAGGGACAATGCCCGAACCGGACGAA
GATGCATCAGAATCTAGCTTAAGGGGCACCTTTAATGACCATGGAGTTTCAAAAGAAAGATCTGTCAGTCACAAGGATGA
GCCTTGGCTGGTGGAAGATTATGAAACCAAAGCGCTTAAAGCAAGCGTAATAGCAGACAGCGGACCATCTCTGCACTTGG
AGAAGTGTGAAAATGTGGTATTGAACCAGACAGTTGGACCAAGGGATAATTTATTCAGGCTCAGTCATGATGACACACTT
GAGCAAGAGAGGATAACGTTTCATTTGGAGAAGTCTCAAGAAAAGCAAGTGAATCTAAGGCAGGCCTTTAAACAGCAAGG
TGACACTGAAGACAACATACCAGCATCTGAAGGCCACGAGTCCCCATGCAAAATGGCCGAAGTAGATAGTGAAGCTGAAG
AAGATATGTTGGGAGACCATTTAGAGCATTTGCAGATAGAGAATGAGAGGTCAGGACTAACCTCTGAACCATATTCTCAT
TTCTATAACACAACGGATCCCTCTGAGATTGTGGGTCTGCGTCTTGCGTTATATGAAACCCAAACTTCACCTCTCAGTTC
ACCAATGCATACTCCCACTGGCTCCCCACTGCACATCCTGATGCGTTCTCCAATTGCTTCACCAATGCATACCCACATAG
TTTCACCAATGCGTTCTCCCATCAACTCATCAGGATCACTCTCTGATGTATTGTTCTTCGGCAAGAAAGCTTGA