Details for Kale Locus Bo6g071110

Position : C6 ( 5`- 20423543 .. 20425040 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g071110

Protein [Map View]
MDIASNNKAIKLKVRDQLLQCHEMTTKVQQLLSQDGSDLGPAKDLVEKILGSISDTISALDSFEPISPSDLVTAAEGSQN
ASCDNDGKLEDSGDSQKRLGPVKGKRGCYKRKKKSETWTVESTVLEDTFSWRKYGQKQILNAKFPRSYFRCTHKYTQGCK
ATKQVQKLESEPRMFSITYIGNHTCNTNEVTPKIKPCIHHDEIITDSEEIQSPSLMTSMKEEEENHHHGSSTESDLQLVW
QEMLVFAEEHHHHHEAVYGCGETSTSINGLDSADLWSCQQFSV*

DNA
ATGGATATTGCTAGTAATAACAAAGCAATAAAGCTAAAAGTTAGGGACCAACTTCTTCAATGCCACGAGATGACCACTAA
GGTTCAGCAACTCCTCTCTCAAGACGGGTCGGATTTGGGTCCAGCGAAGGATCTCGTGGAGAAAATATTGGGGTCTATCA
GTGACACAATCTCTGCTCTTGATTCCTTCGAACCCATCTCCCCCTCTGATCTCGTCACAGCCGCCGAAGGCTCTCAAAAT
GCTTCCTGCGACAACGACGGCAAGCTTGAGGATTCTGGCGATAGTCAGAAAAGATTGGGACCAGTTAAGGGTAAAAGAGG
ATGCTACAAGAGAAAGAAGAAATCAGAGACGTGGACTGTAGAGTCTACCGTACTTGAGGACACATTTTCTTGGAGGAAAT
ATGGACAAAAACAGATTCTTAATGCCAAATTCCCAAGAAGTTACTTTAGGTGCACACACAAATACACTCAAGGGTGCAAG
GCAACAAAGCAAGTGCAGAAGCTAGAGTCTGAACCCAGGATGTTCAGCATCACATACATCGGAAATCACACGTGTAATAC
CAACGAAGTAACACCCAAAATCAAGCCTTGTATTCATCATGATGAGATCATCACGGATTCTGAAGAGATCCAGAGTCCTA
GTTTGATGACCTCGATGAAGGAAGAGGAAGAAAATCACCATCATGGTTCGTCAACGGAGAGTGACTTGCAATTGGTGTGG
CAGGAAATGTTGGTCTTTGCAGAGGAACACCATCATCATCATGAGGCTGTTTACGGTTGTGGGGAAACTAGTACATCTAT
CAATGGTTTGGATTCCGCGGATCTGTGGAGTTGCCAGCAGTTTTCGGTTTAG