Details for Kale Locus Bo6g071060

Position : C6 ( 5`- 20364994 .. 20365760 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g071060

Protein [Map View]
MGLRALPLQHNSGFISTTKVPISRTSQRLSRNPRWVVVSAKQEKDEEKKREDETSLFTRLTDALDFAQVRSEKDAKLLYE
AREATKSGGKMSKEQYGALRRKIGGTYKDFFKSYVEVDGEYVEEGWVDKTCKICKKDTKGEARQVDKAGRYAHVSCLQNP
SNSSGNFFTRLFSR*

DNA
ATGGGTCTAAGAGCACTGCCTCTTCAACATAATAGTGGATTCATCTCCACGACCAAAGTCCCGATCTCAAGAACCTCGCA
GAGATTAAGCCGGAACCCTAGATGGGTCGTGGTGTCGGCCAAGCAAGAGAAAGATGAGGAGAAGAAGAGGGAAGATGAGA
CTTCATTGTTCACCAGACTAACAGATGCGTTGGATTTCGCACAGGTTCGGTCGGAGAAAGACGCCAAGCTTCTCTACGAG
GCCCGTGAAGCCACCAAATCTGGTGGCAAGATGAGCAAAGAACAGTATGGGGCGTTGAGAAGAAAAATCGGAGGGACATA
CAAGGACTTCTTTAAATCCTACGTTGAAGTGGATGGAGAATATGTGGAGGAAGGATGGGTGGACAAAACATGTAAGATAT
GCAAAAAGGACACAAAGGGTGAGGCAAGACAAGTGGACAAGGCAGGGAGATATGCACATGTCTCCTGTCTTCAAAACCCC
TCCAACTCTTCTGGAAATTTCTTCACCAGACTCTTCTCAAGATGA