Details for Kale Locus Bo6g070060

Position : C6 ( 5`- 20337821 .. 20338765 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo6g070060

Protein [Map View]
TPFLPFIKLQRSLIPLSNSDHLPQRLLIFVSSYIVAMSQTVVLKVGMSCQGCGGAVNRVLGKMDGVESFDIDIKEQKVTV
KGNVEPEAVFQTVSKTGKKTSYWPVEAEAEPKAEAEAKAEAVTETKTEAETKTEAETKIETKVDAKADVEQKLAEAETKP
SQV*

DNA
ACACCATTTCTTCCATTCATCAAATTACAAAGATCTCTCATCCCATTATCTAACTCGGATCATCTACCTCAAAGGCTTCT
CATTTTCGTTTCATCTTATATTGTAGCCATGTCTCAGACTGTGGTCCTTAAAGTTGGTATGTCATGCCAGGGCTGCGGTG
GTGCCGTCAATAGAGTCTTGGGAAAAATGGATGGGGTTGAGTCATTTGACATTGATATAAAGGAGCAAAAGGTGACAGTG
AAAGGTAATGTTGAACCTGAAGCAGTTTTTCAAACAGTTTCAAAGACTGGTAAGAAGACTTCTTACTGGCCTGTGGAGGC
TGAGGCTGAGCCTAAAGCTGAGGCCGAGGCTAAGGCTGAGGCCGTGACTGAGACTAAAACCGAGGCTGAGACTAAAACCG
AGGCTGAAACTAAGATTGAGACTAAGGTTGATGCAAAGGCTGATGTTGAACAAAAACTCGCAGAAGCTGAGACTAAGCCA
TCACAAGTTTAA