Details for Kale Locus Bo5g156480

Position : C5 ( 5`- 46882260 .. 46884590 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156480

Protein [Map View]
MQLHISPSMRSLTISSSNEFFDSMKIKVAPPLISYRTLFHTILILAFLLPFVFILTALVTLEGVNKCSSIDCLGRRLGPR
LLGRVDDSERLVRDFYKILNEVSTQEIPDGLKLPNSFRQLVSDMKNNHYDAKTFSLVLRAMIEKFERDMRESKFAELMNK
HFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPERLPVLSDNAYHHFVLATDNILAASVVVSSAVQSSSKPEKIVFHV
ITDKKTYAGMHSWFALNSVAPAIVEVKSVHQFDWLTRENVPVLEAVETHHGIRNYYHGNHIAGANLSETTPRKFASKLQS
RSPKYISLLNHLRIYLPELFPNLDKVVFLDDDIVIQRDLSPLWDIDLHGKVNGAVETCRGEDEWVMSKRLRNYFNFSHPL
IAKHLDPEECAWAYGMNIFDLRTWRKTDIRETYHSWLKANLKSNLTMWKLGTLPPALIAFKGHVQAIDSSWHMLGLGYQS
NTNIENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYLNYSNDFIRSCHILE*

DNA
ATGCAACTTCACATCTCGCCGAGCATGAGAAGCCTCACGATATCGAGCAGCAATGAGTTTTTTGATTCGATGAAGATCAA
AGTCGCGCCTCCTCTCATCTCTTACCGAACTCTCTTCCACACTATCTTAATCCTCGCCTTCCTCTTGCCTTTCGTCTTCA
TCCTCACCGCTCTTGTCACCCTTGAAGGTGTCAACAAGTGCTCCTCCATTGATTGTTTAGGGAGGCGGTTAGGACCACGC
CTTCTTGGTAGGGTAGATGATTCAGAGAGACTAGTTAGAGACTTTTACAAAATTCTAAACGAAGTAAGCACTCAAGAGAT
TCCAGATGGTTTAAAGCTTCCCAATTCTTTTCGTCAACTTGTTTCCGATATGAAGAACAACCACTACGATGCCAAAACGT
TCTCCCTCGTTCTCCGAGCTATGATAGAGAAGTTTGAAAGGGATATGAGGGAATCCAAATTTGCTGAACTTATGAACAAA
CACTTTGCAGCAAGTTCCATTCCAAAAGGGATCCACTGCCTCTCTTTGAGACTAACTGATGAGTACTCCTCAAATGCTCA
CGCTCGGAGACAGCTTCCTTCCCCTGAGCGTCTCCCTGTTCTCTCGGACAACGCTTACCACCATTTTGTCCTAGCTACAG
ACAACATTTTGGCTGCGTCGGTTGTGGTCTCATCCGCTGTTCAGTCGTCTTCCAAGCCTGAGAAAATTGTCTTCCATGTT
ATCACCGACAAGAAAACCTATGCGGGGATGCATTCTTGGTTTGCGCTTAACTCCGTCGCTCCTGCCATCGTTGAAGTCAA
AAGCGTTCATCAGTTTGACTGGCTGACAAGAGAGAATGTTCCTGTTCTCGAAGCTGTGGAGACTCATCACGGTATCAGAA
ACTACTACCATGGGAATCATATCGCTGGTGCAAACCTCAGTGAAACAACTCCAAGAAAATTCGCTTCGAAGTTGCAATCA
AGAAGTCCCAAATACATATCTTTGCTCAACCATCTTAGAATCTATCTACCAGAGCTGTTTCCAAACTTGGACAAGGTGGT
GTTCTTGGATGATGATATAGTGATTCAGAGAGATCTATCTCCTCTTTGGGATATTGATCTTCACGGGAAGGTGAATGGAG
CCGTGGAGACTTGTAGAGGAGAAGACGAATGGGTTATGTCAAAGCGTCTCAGGAACTACTTCAACTTCTCTCACCCTCTC
ATAGCAAAGCATTTGGATCCGGAGGAATGTGCTTGGGCTTACGGAATGAATATCTTTGATCTACGGACTTGGAGGAAGAC
AGACATCAGAGAAACTTATCATTCTTGGCTAAAAGCGAATCTGAAGTCTAACTTAACAATGTGGAAACTGGGGACATTGC
CTCCAGCTCTGATTGCATTTAAAGGGCATGTTCAGGCAATAGATTCTTCTTGGCACATGCTTGGATTAGGATACCAGAGC
AATACCAACATCGAAAACGTGAAGAAAGCTGCGGTGATTCACTACAATGGGCAATCAAAGCCGTGGCTGGAGATAGGTTT
CGAGCATCTGAGACCGTTCTGGACAAAATATTTGAACTACTCCAATGATTTCATCAGGAGCTGTCATATCTTGGAATAG