Details for Kale Locus Bo5g156470

Position : C5 ( 5`- 46880118 .. 46880978 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156470

Protein [Map View]
MPRIALMAAVVVVACLAAGLVSEVAAKKWTVGNNKFWNPNVNYTVWAQDKHFYFDDWLYFVYERNQYNVIEVNETNYISC
NSDNPIANWSRGSGRDVVHLNVTKHYYLISGYGGGCYAGMKLSILVEKPPLPPAPAPNKSNARRAFTVSAFAPQFVIPVA
VFAAIGLMWDNVVLPFW*

DNA
ATGCCGAGAATTGCTTTGATGGCTGCGGTAGTGGTGGTGGCTTGTCTTGCGGCAGGGCTGGTGAGTGAAGTGGCGGCGAA
GAAATGGACGGTGGGAAATAACAAGTTCTGGAATCCCAATGTCAATTATACCGTTTGGGCTCAGGACAAACATTTCTACT
TCGACGACTGGCTCTATTTTGTGTACGAGAGAAACCAATACAACGTTATAGAAGTGAACGAGACCAACTACATAAGCTGC
AATTCCGATAACCCCATCGCTAACTGGAGTCGTGGATCCGGAAGGGACGTCGTTCATCTCAATGTGACCAAACATTACTA
CCTCATTAGCGGTTATGGTGGTGGATGTTACGCCGGTATGAAGCTCTCTATTTTAGTTGAGAAGCCGCCTCTTCCACCAG
CTCCAGCACCTAACAAAAGCAATGCAAGAAGAGCCTTCACCGTCTCAGCTTTTGCTCCTCAGTTTGTTATTCCGGTAGCT
GTTTTTGCAGCAATAGGGTTAATGTGGGACAATGTGGTACTACCTTTTTGGTAA