Details for Kale Locus Bo5g156460

Position : C5 ( 5`- 46867729 .. 46872955 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156460

Protein [Map View]
MAVGDDVSSMRTTTLVAPTRPTITVPQRPPAIETAAYFLGGGDGLSLSPGPLSFVSSLFVDSFPDLLTPDNQRTTSFSQL
LAGAMSVSPGSGRSTAGMIAGGGPLFTIPSGFSPSSLLTSPMFFPPQQSPTQTVFVQPQSQPKRPDSFPNQMPPSTSTTV
HGRRSCKAPQADRYNNPAANNNNTNRSYNVVHVDKPADDGYNWRKYGQKPIKGCEYPRSYYRCTHVNCPVKKKVERSSDG
QITQIIYKGQHDHERPQNRRGGGGELRGSGEIGDIHYIGGVGHMESSDDSGYANDHDNDNDDDNEDIPASKIRKIDGGVS
TTHRSVTEPKIIVQTRSEVDLLDDGYRWRKYGQKVVKGNPHPRSYYKCTTANCTVRKHVERASTDVKAVITTYEGKHNHD
VPAARNGTAPATPATAGIVLPALDPFTRPGSILTPPGNFLTISSSIMGCFNSKHSSPPPRPIRRRSDTAANRGHPQNTHK
PYVLPTPPSHRRVVNSSPKKHHNNDDDAPRSKTTGVSHRSGLPHGNVEVEQVAAGWPSWLTSASPEAVHGLVPLRAEDFE
KREKIGQGTYSNVFRACEISTGRVMALKKIRVQNFDTENIRFIAREIMILRRLDHPNIMKLEGIIASRNSNSMYFIKCYM
QQLLLAVEHCHLRGIMHRDIKAANILVNNKGVLKLADFGLANIVTPRNKNQLTSRVVTLWYRAPELLMGSTSYSVSVDLW
SVGCVFAEILTGRPPLKGRTEIEQLHKIYKLCGSPDEELWRNNRLHPQTKMFGQQHQYEGCLRETFEEFPKTAVNLLENL
FSIDPEKRGTASSALMSEYFNTKPYACDPSTLPKYPPNKEMDAKYREELQRRRRATIKKRDNLVSKKTGKSRRTIKDPLS
KLPTQQETKKEAETEITLQTPSETSQATTRSEFPYTALSQATAPASGFAWAGAKKRKENDAASTLTYNQPAGSASHVSGM
SMAFAKNTFGLTINEDRPFLRPHVSLDSSGDILLYPNVHHKKEEDNMSQLNSDLRNVGANPKIFQTNGMNEILRRTESDA
RVAVRRPPRIERG*

DNA
ATGGCTGTAGGGGATGATGTATCTTCGATGAGAACAACGACGTTAGTCGCTCCAACAAGACCCACGATCACAGTTCCTCA
GAGACCACCGGCGATCGAAACGGCGGCGTACTTTTTAGGAGGTGGAGATGGTCTTAGTCTAAGCCCAGGCCCACTTTCTT
TTGTGTCGTCTTTGTTCGTTGATAGCTTCCCTGACCTCTTGACTCCGGATAATCAAAGGACAACATCATTTTCTCAGCTT
CTCGCCGGAGCTATGTCGGTGTCTCCCGGTAGTGGACGTTCTACGGCGGGGATGATCGCCGGTGGAGGACCGTTGTTTAC
AATTCCTTCTGGTTTCAGCCCTTCTAGTCTTCTCACCTCTCCAATGTTCTTTCCTCCTCAGCAGTCACCTACTCAAACCG
TCTTTGTTCAACCGCAGTCGCAACCAAAACGACCAGACTCATTTCCTAACCAAATGCCGCCATCGACATCCACGACCGTT
CATGGCCGTCGATCATGTAAAGCTCCGCAAGCCGATCGTTATAATAATCCGGCGGCGAATAACAACAATACTAACCGGTC
TTATAATGTGGTGCACGTTGATAAACCGGCGGATGACGGCTATAACTGGAGGAAGTACGGCCAAAAGCCTATAAAAGGGT
GTGAATATCCGAGGAGTTATTATAGATGCACACATGTTAATTGTCCGGTTAAGAAGAAAGTTGAACGGTCATCAGATGGA
CAGATCACTCAGATCATTTACAAAGGTCAACATGACCACGAGAGGCCTCAGAACCGCCGTGGCGGTGGTGGTGAACTTAG
AGGTTCCGGCGAAATTGGTGATATTCATTACATTGGTGGTGTAGGACATATGGAGTCTAGTGATGATAGCGGTTATGCTA
ATGATCATGACAATGATAATGATGATGACAATGAAGATATTCCAGCTTCAAAGATAAGAAAAATTGACGGAGGTGTGTCG
ACAACTCACCGTTCCGTGACCGAGCCAAAGATCATCGTTCAGACAAGAAGTGAAGTCGACCTCCTCGACGATGGTTATAG
GTGGCGCAAGTACGGACAAAAGGTTGTCAAAGGAAACCCCCATCCGAGGAGCTACTATAAGTGTACAACTGCGAATTGTA
CGGTACGTAAACATGTAGAGAGAGCTTCTACGGATGTGAAGGCTGTCATTACAACTTATGAAGGTAAACATAACCATGAC
GTCCCTGCCGCTAGAAATGGCACCGCCCCAGCAACCCCAGCCACAGCGGGGATCGTCCTCCCTGCGTTGGACCCGTTTAC
CCGTCCCGGGTCGATCCTCACGCCGCCCGGAAACTTTCTGACAATTAGTTCATCCATCATGGGTTGCTTCAACTCCAAGC
ATTCTTCTCCTCCTCCACGCCCTATCCGCCGCCGTTCAGACACAGCCGCCAACCGAGGCCATCCCCAAAACACCCACAAA
CCCTATGTTCTTCCCACTCCGCCATCTCACCGCCGTGTCGTCAACTCATCTCCTAAAAAACATCACAATAATGACGATGA
CGCTCCAAGATCGAAGACGACCGGAGTTAGCCATAGATCGGGATTGCCGCATGGAAATGTAGAGGTTGAGCAGGTGGCTG
CTGGTTGGCCATCATGGCTAACCTCCGCCTCACCAGAGGCCGTTCATGGGTTGGTCCCGTTACGTGCAGAGGACTTCGAG
AAAAGAGAGAAGATTGGACAAGGGACGTATAGCAACGTGTTCCGGGCTTGTGAGATATCGACGGGACGAGTCATGGCTCT
AAAGAAAATAAGGGTTCAAAACTTTGACACAGAAAACATAAGATTCATAGCAAGAGAAATCATGATTTTGAGAAGATTAG
ATCATCCAAACATCATGAAACTCGAAGGTATCATCGCCTCACGGAACTCAAACAGCATGTACTTTATCAAATGTTATATG
CAGCAGCTTCTATTGGCAGTAGAACATTGTCATTTACGAGGGATCATGCACAGAGACATTAAAGCAGCAAACATTCTGGT
GAATAACAAAGGAGTTTTGAAGCTAGCTGATTTCGGACTAGCCAACATTGTAACACCAAGAAACAAGAATCAGTTAACAA
GTCGGGTTGTGACGCTCTGGTACCGTGCACCCGAACTTCTAATGGGTTCCACGAGTTATAGCGTGTCGGTCGATCTTTGG
AGCGTCGGATGTGTTTTCGCCGAGATTCTTACCGGAAGACCACCTCTTAAAGGAAGAACAGAGATTGAACAACTTCACAA
GATTTATAAACTATGTGGATCACCAGATGAAGAACTTTGGAGAAATAACAGGCTTCATCCTCAAACTAAAATGTTTGGAC
AACAACATCAGTACGAAGGTTGTCTGAGAGAAACATTTGAGGAGTTCCCAAAAACAGCAGTTAATCTTCTGGAGAATCTA
TTTTCTATTGATCCGGAGAAACGAGGAACTGCCTCTTCTGCTCTCATGTCAGAGTACTTTAATACAAAGCCTTACGCTTG
TGATCCATCGACGTTACCTAAGTACCCTCCTAACAAAGAAATGGATGCTAAGTACCGTGAAGAACTTCAACGAAGGAGAA
GAGCAACTATAAAGAAAAGAGATAACTTGGTATCCAAGAAAACGGGGAAATCACGTAGAACAATCAAAGACCCTCTTAGC
AAGTTACCAACCCAACAGGAAACGAAGAAAGAAGCCGAGACAGAGATCACTCTCCAGACGCCATCAGAGACATCTCAAGC
GACCACTCGAAGCGAGTTCCCGTACACTGCTCTATCTCAAGCCACGGCGCCGGCAAGCGGGTTCGCATGGGCTGGAGCGA
AGAAGAGGAAAGAAAACGACGCAGCTTCGACGCTGACATATAATCAGCCTGCAGGATCTGCGAGCCACGTGAGTGGTATG
AGCATGGCTTTTGCTAAGAACACATTCGGGCTAACAATAAACGAGGACAGACCATTTCTTAGGCCACACGTTTCTTTAGA
CTCCTCTGGTGATATCTTGTTGTACCCTAACGTGCATCACAAGAAAGAAGAAGATAATATGAGTCAACTAAATTCGGATT
TGAGGAATGTTGGGGCGAATCCAAAGATTTTTCAAACCAATGGGATGAATGAGATATTAAGGAGAACAGAAAGTGATGCA
AGAGTCGCTGTTCGAAGACCGCCACGGATAGAAAGAGGTTAA