Details for Kale Locus Bo5g156450

Position : C5 ( 5`- 46864721 .. 46867035 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156450

Protein [Map View]
MDGSGGRGGVESILPNYKLGRTLGIGSFGRVKIAEHSLTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRL
YEVIETPTDIYLVMEYVNSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKSNVKIADFG
LSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSA
GARDLIPRMLVVDPMKRVTIPEIRQHNWFQAHLPRYLAVPPPDTAQQAKKIDEEILQEVINMMGFDRNLLIESLRNRTQN
DGTVTYYLILDNRFRVSAGYLGAEFQETMEGTPRMHPAESVASPVSNRLPGLMEFQGVGLRSQYPVERKWALGLQSRAHP
REIMTEVLKALQDLNVCWKKIGPYNMKCRWVLNNADNSMQDNNYFGDDSSIIENDAAVKSPNVVKFELQLYKTRDDKYLL
DLQRVLGPQFLFLDLCAAFLAQLRVL*

DNA
ATGGATGGATCAGGAGGTAGAGGTGGTGTTGAATCGATTCTACCAAACTACAAGCTCGGGAGGACTCTTGGTATCGGTTC
CTTTGGTAGGGTTAAGATTGCTGAGCACTCTTTGACCGGACACAAAGTTGCTATCAAGATCCTCAATCGTCGCAAAATCA
AGAACATGGAGATGGAGGAGAAAGTGAGGAGAGAGATCAAAATCTTGAGACTCTTTATGCATCCTCACATCATCCGTCTC
TACGAGGTCATTGAGACTCCCACAGATATCTATCTCGTCATGGAGTATGTCAACTCTGGTGAGCTGTTTGACTATATTGT
GGAGAAGGGTCGGTTGCAGGAGGACGAGGCCAGGAACTTTTTTCAGCAGATAATATCTGGAGTGGAGTATTGCCATCGGA
ATATGGTAGTTCACAGAGACCTTAAGCCTGAGAACTTGCTTCTGGACTCCAAAAGCAACGTTAAGATTGCTGATTTTGGC
CTGAGCAACATTATGCGAGATGGTCACTTTTTGAAGACTAGCTGTGGTAGTCCAAATTACGCTGCTCCAGAGGTAATTTC
GGGCAAGCTATATGCTGGCCCTGAAGTAGACGTCTGGAGCTGTGGAGTGATACTCTATGCTCTTCTTTGTGGGACTCTTC
CGTTCGATGATGAGAACATTCCCAACCTTTTTAAGAAGATTAAGGGAGGGATATATACTCTGCCTAGCCATTTATCTGCT
GGTGCTAGAGATTTGATCCCCAGGATGCTCGTGGTGGACCCCATGAAAAGAGTAACCATACCTGAGATCCGGCAACACAA
TTGGTTCCAAGCTCATCTTCCAAGGTATTTGGCTGTCCCTCCTCCAGATACGGCCCAGCAAGCTAAAAAGATTGATGAGG
AAATTCTCCAAGAAGTTATCAATATGATGGGATTTGACAGAAACCTCCTCATTGAATCTCTCCGCAACCGGACCCAGAAT
GATGGAACTGTGACATACTATCTGATACTGGACAACCGGTTCCGTGTCTCTGCTGGTTATCTCGGGGCCGAGTTTCAAGA
GACGATGGAAGGTACTCCGCGTATGCATCCAGCAGAAAGCGTAGCTTCACCAGTTAGCAATCGGCTTCCAGGACTGATGG
AGTTCCAAGGAGTTGGCTTAAGATCTCAATACCCTGTTGAGAGAAAATGGGCTCTTGGACTTCAGTCCCGTGCTCATCCA
CGCGAGATAATGACAGAAGTCCTGAAAGCCCTGCAAGATCTGAATGTGTGCTGGAAGAAGATAGGGCCGTACAACATGAA
GTGCAGATGGGTTCTTAACAACGCAGATAACTCGATGCAGGACAACAACTACTTTGGAGATGATTCCAGCATAATAGAGA
ACGACGCAGCTGTGAAGTCGCCTAATGTTGTCAAGTTTGAACTTCAGTTGTATAAAACACGGGACGACAAGTATCTGCTG
GATCTGCAGAGGGTGCTAGGTCCTCAGTTCTTGTTCTTGGATCTCTGTGCTGCCTTCCTTGCTCAGCTCCGAGTCCTCTG
A