Details for Kale Locus Bo5g156440

Position : C5 ( 5`- 46860315 .. 46863641 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156440

Protein [Map View]
MILSALLTSVGINLGLCFLFFTLYSILRKQPGNVTVYGPRLIQAGKSQQTNAFNLERLLPTAGWVKRALEPTNEEILSNL
GLDALVLTRVFVFSIRVFSFASVVGIFILLPVNYMGTEFEEFFDLPNKSLDSFSISNVNDGSNKLWIHFCAIYIFSAVVC
YLLYCEHKYISSKRIAHFYSSKPQPQEFTVLVSGVPLVSGNSISETVESFFREYHSSTYLSHVVVHRTDKLKVLMNDAEK
LYKKLTRVKSGSISRQKSKRDGFLGMFGKRVDVVDHYEKKLEKLEDDMRLKQSLLAGEEIPAAFVSFRTRHGAAIASNIQ
QGMDPTQWLTETAPEPQDVHWPFFTASFVRRWISNVVVFVAFVALIILYVIPVVLVQGLANLHQLETWFPFLKSILNMKI
VSQVITGYLPSLIFQLFLMIVPPVMLLLSSMQGFISHSQIEKSACIKLLVFTVWNSFFANVLSGSALYRVNVFLEPKNIP
RVLAAAVPAQASFFISYVVTTGWTGLSSEIFRLVPLLYSFMTKLFCKEDEKEFEVPPTPLCQEIPRILFFGLLGTTYFFL
SPLILPFLLVYFCLGYVIYRNQLLNVYEAKYETGGKFWPIVHSSTIFSLVLMHIIAIGLFGLKKLPLASSLTIPLPVLTL
LFSIYCQRRFLPNFKSYPTECLVNKDKADEREENMSEFFSELVVAYRDPALSASQYSRDMSPEDPPLLRSYQS*

DNA
ATGATTCTGTCAGCACTTTTAACTTCAGTGGGAATCAACCTTGGCCTCTGTTTCCTCTTCTTCACTTTGTATTCCATATT
GAGAAAGCAGCCTGGTAATGTCACCGTCTACGGTCCACGGCTTATTCAAGCTGGCAAATCTCAGCAGACAAATGCCTTCA
ACCTCGAGAGGCTTTTGCCTACTGCTGGTTGGGTCAAAAGAGCTTTGGAGCCTACCAACGAAGAGATCCTCTCCAATCTT
GGCTTAGATGCTTTGGTCCTCACTCGTGTCTTTGTCTTCAGTATACGAGTGTTTAGCTTTGCTTCTGTGGTTGGGATCTT
CATCCTTCTTCCAGTGAACTATATGGGTACTGAGTTTGAAGAGTTTTTCGACCTTCCAAACAAGTCTCTTGATTCCTTCA
GCATCTCTAATGTTAACGATGGATCAAACAAGTTGTGGATTCACTTTTGCGCAATTTACATCTTCTCCGCGGTTGTTTGC
TATCTGCTCTACTGTGAGCACAAATATATTTCATCAAAGCGGATTGCTCATTTTTATTCATCCAAGCCTCAGCCGCAAGA
GTTCACGGTTCTGGTCAGTGGCGTCCCTCTTGTGTCTGGAAACAGTATCAGTGAAACTGTGGAAAGCTTTTTCAGGGAGT
ATCATTCTTCCACTTATCTTTCTCACGTTGTTGTTCATCGGACTGACAAGTTAAAGGTTCTCATGAATGATGCTGAGAAG
CTATACAAGAAACTTACTCGAGTGAAATCAGGAAGCATATCTCGTCAGAAGTCTAAGAGGGATGGGTTCTTAGGGATGTT
TGGGAAGAGAGTTGATGTGGTTGATCATTACGAAAAGAAGCTCGAGAAGTTAGAAGACGACATGAGGTTGAAACAGTCTT
TACTAGCCGGAGAGGAAATTCCAGCGGCTTTCGTTTCCTTTAGGACAAGACATGGTGCTGCAATAGCATCAAACATTCAG
CAAGGAATGGATCCAACACAATGGCTAACTGAGACAGCCCCGGAGCCTCAAGATGTTCACTGGCCATTTTTCACCGCATC
GTTCGTGAGGAGATGGATCTCCAACGTGGTGGTATTCGTGGCTTTCGTAGCTCTGATAATCCTATACGTTATCCCTGTTG
TATTGGTTCAAGGTCTTGCTAATCTTCACCAGTTAGAAACATGGTTCCCTTTTCTTAAAAGCATACTAAATATGAAAATT
GTGAGTCAAGTGATTACAGGATACCTTCCGAGTCTAATTTTCCAGCTTTTCCTTATGATAGTACCACCCGTTATGCTTCT
ACTTTCCTCAATGCAAGGATTCATTTCTCATAGCCAGATTGAGAAATCTGCGTGTATCAAGCTTCTAGTCTTCACTGTGT
GGAACAGTTTCTTTGCAAATGTACTCTCCGGATCTGCTCTTTATCGTGTTAATGTGTTCCTTGAACCTAAGAACATTCCC
CGTGTGCTTGCTGCAGCTGTTCCAGCACAGGCATCGTTCTTTATATCTTATGTTGTGACCACTGGGTGGACTGGTTTATC
ATCAGAGATCTTCCGTTTGGTTCCTCTTCTCTATAGTTTTATGACGAAACTCTTCTGTAAGGAAGATGAAAAAGAGTTTG
AGGTCCCTCCCACTCCCTTGTGCCAAGAAATCCCAAGGATTCTCTTTTTTGGACTTCTTGGTACAACTTACTTCTTCCTC
TCGCCGTTGATACTGCCTTTCTTGTTGGTCTACTTTTGTCTTGGATATGTCATCTACCGCAACCAGCTCCTAAACGTATA
TGAGGCCAAGTATGAAACTGGTGGGAAGTTTTGGCCAATAGTACACAGCTCCACTATCTTCTCTTTGGTGCTAATGCACA
TTATTGCAATTGGATTATTCGGCCTTAAAAAGCTTCCATTAGCATCTTCTTTAACGATTCCCCTCCCGGTTCTCACCCTC
CTTTTCAGCATCTACTGCCAGAGACGATTCTTGCCCAATTTCAAATCTTATCCTACGGAGTGTCTAGTAAACAAAGACAA
AGCAGACGAGAGAGAAGAGAACATGTCTGAATTCTTTTCTGAACTCGTGGTTGCATACCGTGATCCTGCGCTATCGGCAT
CGCAGTACTCACGGGACATGTCACCTGAGGATCCTCCGCTTCTTCGTTCATATCAATCCTGA