Details for Kale Locus Bo5g156430

Position : C5 ( 5`- 46856535 .. 46859082 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156430

Protein [Map View]
MAVLSFQSPTNFSASSIPGSSRRRFDSTAGSPSSFTGDGPISSMILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNN
PSSGLQSAAAAASSVSAAASAPAAAVTPPVVALNGVDEEVVAAEGAREIGLKKDSKPSFLSSDGSLTVHAGERLGRGIVT
DAITTPVVNTSAYFFNKTADLLDFKEKRSVSFEYGRYGNPTTIVLEEKISALEGAESTLVMASGMCASTVMLLALVPAGG
HIVTTTDCYRKTRIFMENFLPKMGITVTVIDPADIAGLEAAVNKYQVSLFFTESPTNPFLRCVDIELVSEICHKRGTLVC
IDGTFATPLNQKALAFGADLVVHSLTKYIGGHNDVLGGCICGPLKIVSEIRNLHHVLGGTLNPNAAYLMIRGMKTMHLRV
QQQNSTASRMAEILEAHPKVSHVYYPGLASHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGGCES
IVDQPAIMSYWDLTQEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI*

DNA
ATGGCCGTCTTGTCGTTCCAGAGCCCTACAAACTTCTCCGCATCCTCCATCCCCGGCTCGTCTCGACGCCGTTTCGACTC
CACCGCCGGCTCACCGTCGTCATTCACGGGAGACGGCCCTATATCCTCAATGATCCTGAGGTTCCCTCCCAATTTCGTCC
GCCAGCTCAGCATCAAAGCCCGCAGAAACTGCAGCAACATCGGCGTCGCGCAGATCGTCGCCGCCAAGTGGTCCAACAAC
CCCTCCTCCGGTTTACAGTCGGCGGCGGCGGCAGCATCGTCTGTTTCCGCCGCCGCCTCGGCCCCTGCGGCCGCCGTTAC
TCCTCCCGTAGTCGCGCTGAATGGCGTGGACGAGGAGGTTGTGGCGGCCGAGGGAGCCAGGGAGATAGGGTTGAAGAAGG
ATTCGAAACCCTCATTTTTGAGCTCCGATGGGAGCCTCACTGTTCATGCCGGTGAAAGATTAGGTCGTGGTATAGTCACG
GATGCAATCACCACTCCTGTAGTCAACACATCTGCCTACTTCTTCAACAAAACTGCTGACCTTCTTGACTTCAAGGAGAA
ACGGAGTGTCAGTTTCGAGTATGGTCGTTATGGCAACCCGACCACTATCGTTCTTGAGGAGAAGATAAGTGCACTTGAAG
GTGCTGAATCAACCTTGGTTATGGCTTCTGGAATGTGTGCAAGCACTGTTATGCTTTTGGCTTTGGTTCCTGCTGGTGGA
CACATTGTGACTACTACCGATTGTTACCGGAAGACTAGAATCTTCATGGAGAATTTTCTTCCCAAGATGGGCATCACTGT
CACTGTGATTGATCCTGCTGATATCGCCGGGCTTGAAGCTGCTGTGAATAAGTACCAAGTCTCTCTGTTCTTCACTGAGT
CACCGACAAACCCATTCCTTAGATGCGTCGACATTGAGCTAGTTTCAGAAATATGCCACAAGAGGGGAACTCTTGTTTGC
ATCGATGGCACCTTTGCAACACCTCTGAATCAGAAAGCCCTTGCTTTTGGTGCTGATCTTGTCGTGCACTCTCTTACAAA
GTACATCGGAGGACACAACGATGTTCTTGGTGGATGCATCTGTGGCCCACTGAAGATAGTTTCAGAAATTCGCAATCTGC
ATCATGTGTTGGGAGGCACACTTAATCCGAACGCAGCGTACCTAATGATCCGAGGCATGAAGACAATGCATCTTCGTGTA
CAGCAACAGAATTCAACTGCCTCAAGGATGGCCGAAATTTTAGAGGCACATCCTAAGGTGAGTCATGTGTACTATCCAGG
CCTTGCAAGTCATCCCGAGCATCACATTGCCAAGCGACAAATGACTGGTTTTGGAGGTGTAGTCAGTTTCGAGATTGATG
GAGACATAGAAAGAACGATAAAGTTTGTGGACTCTCTCAAGATTCCTTACATCGCACCATCTTTTGGTGGCTGCGAAAGC
ATCGTGGACCAACCGGCCATCATGTCTTACTGGGATCTGACGCAGGAGGAGAGGCTAAAGTATGGAATCAAAGACAATTT
GGTTCGTTTCAGCTTCGGAGTTGAAGACTTTGAAGATGTCAAAGCTGACGTTCTTCAAGCTCTCGAGGCCATCTGA