Details for Kale Locus Bo5g156420

Position : C5 ( 5`- 46852848 .. 46853596 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156420

Protein [Map View]
MTPPPGLYSGRSTLALVARASAFGLGLIYGNVKLKALKIKKNSQIKAEAKAEAKAHH*

DNA
ATGACGCCGCCTCCAGGACTTTACTCCGGTCGCAGCACTCTTGCCCTGGTGGCTCGTGCTTCGGCTTTCGGGCTGGGTCT
CATCTACGGCAACGTCAAGCTCAAGGCTTTGAAGATAAAGAAGAACTCACAGATTAAGGCTGAAGCCAAGGCGGAAGCCA
AGGCTCATCACTAA