Details for Kale Locus Bo5g156410

Position : C5 ( 5`- 46850025 .. 46851272 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156410

Protein [Map View]
MGRSPCCDKDGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNYLRPDIKRGKFTVQEEQTIIQ
LHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMGIDPVTHKHKNETLLSSTGQSKNLATLSHMAQWESARLEAE
ARIARESKLLHVQHHRNNKPAAPDYCLAHKSSSTNWTKPNQGNGDQQLESPTSTVTFSENLPLMIMHLGIPMENRNSRVA
VSSSTSSIKDSDHDWIKQINCPKEGIEEGFTSLLLRDSVDRSLSTGKNDEAIAESVAGAVEVNESEYSYYEDNKNYWNSI
LSLVDSSPSDSPTMF*

DNA
ATGGGAAGATCGCCGTGCTGTGATAAGGATGGTTTAAAGAAAGGGCCATGGACACCAGAAGAGGATCAGAAACTCTTGGC
TTACATTGAAGAACATGGCCATGGAAGCTGGCGCTCTTTGCCTGAGAAAGCCGGTCTCCAAAGATGTGGAAAGAGTTGCA
GACTGAGATGGACTAATTACCTAAGACCTGACATCAAGAGAGGCAAATTCACTGTACAAGAAGAACAAACCATCATTCAA
CTCCACGCTCTCCTCGGAAACAGATGGTCAGCGATTGCAACTCATTTACCGAAAAGGACAGACAACGAGATAAAGAACTA
CTGGAACACACACTTGAAGAAACGTCTGGTCAAAATGGGGATAGATCCAGTGACACACAAGCACAAAAACGAGACGCTCT
TGTCTTCCACAGGTCAATCCAAGAACTTAGCCACGCTTAGCCACATGGCTCAGTGGGAGAGTGCTCGGCTCGAAGCTGAA
GCAAGGATAGCTAGAGAATCAAAGCTTCTCCATGTACAGCATCACCGAAACAACAAACCAGCAGCTCCTGATTATTGCTT
GGCTCACAAGTCATCATCAACAAATTGGACAAAACCAAACCAAGGAAACGGAGATCAACAGCTTGAGTCTCCGACGTCGA
CGGTGACATTCTCCGAGAATCTCCCTCTGATGATCATGCATTTAGGAATCCCCATGGAAAACAGAAACAGCAGAGTCGCC
GTCTCTTCTTCCACCTCCTCCATCAAAGATTCCGACCACGACTGGATCAAGCAAATCAACTGTCCAAAAGAAGGAATCGA
AGAAGGATTCACGAGCCTCCTGCTCCGTGATTCAGTTGACCGGAGTCTCTCCACCGGTAAAAACGACGAGGCGATCGCAG
AATCCGTCGCCGGCGCGGTCGAGGTAAACGAGAGTGAGTATAGCTACTATGAGGATAACAAGAACTACTGGAATAGCATT
CTCAGCTTGGTTGATTCATCACCGTCCGACTCTCCGACGATGTTCTGA