Details for Kale Locus Bo5g156390

Position : C5 ( 5`- 46840732 .. 46843405 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156390

Protein [Map View]
MGSKRKKGDEMITDSRFSKAHTDPRFRRLPRRESKVTIDSRFKGVLTDKASAPVDKRGKRRRRGSAKDSLKEYYRIEEDD
KKKKKKQKQKRKEDSEEEGESGDDGSEGEEKLMALEPEEQSNEEKSAEELKSEEKILPLELASESEDEQDNDDVSEEEVD
SDVDDEDMYDDDEPEVAEEEIASIEKETHRLAIVNMDWKHVTAKDLYVVFNSFLPKDGRLLSVAVYPSEFGLERMKEEEI
HGPAIGGDNVDNSDEDDDGDEDKDLINESIRDYEKSRLRYYFAVAECDSSATADHLYKSCDGIEFERSSNKLDLRFIPDS
MEFKHPPRDIATEAPATYQGLDFQSRALQMSRVNFAWDEDEPHRVRTLNQRFNPDQLAELELKEFLASDDSESDDDDDGG
DDDEEKRKEKYLALMESGDVDSDKDEDEENDQDMVVEFNTGLENLSNKFREKKEEKPETVWEAQLRKMQEKKKARRMQKK
DDDDDSPDDDDDDSSDDEDDYTVDDHKKKKKMMMKNKNKKGLEEKLAADERSRVELELILADENGGDGKGLKGYNIKRKS
KKRSKEMAEEKIPSADPDDSRFSAAITDPNYALDPTNPQFKRSATYVKQLTQKQKEDPRSQEEQVKDVETKKASTKEDTV
GSSKKRSFAESATVKSLKLKMQQKGSEKKKEGTADLAQRLKKKARALSNK*

DNA
ATGGGTTCCAAGCGTAAGAAGGGAGACGAGATGATTACGGATTCGAGGTTTTCGAAGGCTCACACTGACCCCAGATTCCG
TAGGCTTCCCAGGCGTGAATCCAAAGTCACCATTGACTCTCGTTTCAAAGGTGTCCTCACCGATAAAGCTTCTGCTCCGG
TTGATAAGCGTGGGAAGCGTAGAAGACGAGGAAGTGCCAAGGATTCTCTCAAAGAGTATTACCGTATCGAAGAAGACGAT
AAGAAGAAGAAGAAGAAGCAGAAGCAGAAGCGCAAGGAGGATAGCGAAGAAGAGGGTGAATCTGGGGATGATGGGAGCGA
GGGTGAAGAAAAGTTGATGGCTTTGGAACCTGAGGAACAATCTAATGAAGAGAAGTCTGCTGAAGAGCTTAAGAGCGAGG
AGAAGATTCTTCCTTTAGAATTGGCTTCAGAGTCTGAAGATGAGCAAGACAATGATGATGTTTCGGAAGAAGAGGTGGAT
TCTGACGTGGACGATGAAGATATGTATGATGACGATGAACCCGAAGTTGCCGAAGAGGAGATAGCGAGTATCGAGAAAGA
AACTCACAGACTCGCTATTGTCAACATGGACTGGAAACATGTCACTGCCAAAGACTTGTACGTTGTTTTCAATTCGTTTC
TCCCGAAAGATGGGCGTCTTTTGTCAGTTGCTGTCTATCCATCAGAGTTTGGGCTTGAGCGAATGAAAGAGGAGGAAATC
CATGGCCCGGCAATCGGTGGAGACAATGTAGATAACAGCGATGAAGATGATGATGGAGATGAGGATAAGGACCTCATCAA
TGAGAGTATACGTGATTACGAAAAAAGCAGATTGAGGTACTATTTTGCTGTTGCGGAATGTGATTCCAGTGCCACTGCTG
ATCACTTGTACAAATCATGTGATGGAATCGAGTTTGAGAGATCCTCTAACAAGCTCGACTTAAGATTCATTCCTGACTCC
ATGGAATTCAAACATCCACCTCGTGACATTGCCACCGAGGCACCTGCTACTTATCAAGGTTTAGATTTTCAAAGCCGAGC
ACTGCAGATGAGTAGGGTTAATTTTGCTTGGGATGAAGATGAGCCGCACCGTGTTAGGACCTTAAACCAGAGATTCAACC
CTGATCAGTTGGCAGAACTTGAGCTGAAGGAGTTTTTAGCTTCTGATGATAGTGAATCTGATGATGATGATGATGGTGGT
GATGATGATGAGGAAAAAAGAAAAGAAAAGTACCTAGCTTTAATGGAATCCGGAGATGTTGATTCTGATAAAGACGAGGA
CGAGGAGAATGATCAGGATATGGTAGTAGAATTCAATACGGGGCTAGAAAATCTGAGTAACAAATTTCGTGAAAAGAAAG
AAGAGAAGCCAGAAACGGTCTGGGAGGCACAACTAAGGAAGATGCAGGAGAAGAAGAAAGCTAGGAGGATGCAAAAGAAG
GATGATGATGATGATTCCCCAGATGATGATGATGATGATTCTTCAGATGATGAAGACGACTATACCGTTGATGATCATAA
GAAGAAGAAGAAGATGATGATGAAGAATAAGAATAAGAAGGGTTTAGAGGAGAAATTAGCAGCGGACGAAAGAAGCAGAG
TGGAGCTCGAGTTGATACTGGCTGATGAGAATGGAGGAGACGGCAAAGGTCTAAAAGGATATAATATTAAAAGGAAAAGT
AAAAAGAGAAGTAAAGAGATGGCAGAAGAGAAGATACCTTCAGCTGATCCTGACGATTCAAGATTCTCAGCTGCAATCAC
GGATCCTAACTATGCTCTAGACCCTACGAATCCACAGTTTAAAAGGAGTGCGACTTATGTTAAGCAATTAACTCAGAAGC
AAAAGGAAGATCCAAGAAGCCAAGAAGAGCAAGTGAAAGATGTGGAGACAAAGAAGGCGTCGACTAAAGAGGACACGGTG
GGATCTTCTAAGAAAAGGAGTTTTGCAGAGTCTGCTACTGTCAAGTCGTTGAAGCTCAAGATGCAGCAGAAGGGTTCGGA
GAAGAAGAAAGAAGGGACTGCCGACTTGGCTCAGCGACTGAAGAAGAAAGCCAGAGCTTTATCAAACAAATAA