Details for Kale Locus Bo5g156360

Position : C5 ( 5`- 46832640 .. 46833847 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156360

Protein [Map View]
MAACKRLVVACFFLVLLLAEANAQGLKVGFYRKTCPHAEGIVKKVVFAAMKKAPTLGAPLLRMFFHDCFVRGCDGSVLLD
SSNNQAEKNAVPNLSLRGFDILDDSKAALEKVCPGIVSCSDILALVARDAMVALEGPTWEVETGRRDGRVSNINEVNLPS
PFDNITKLITDFRTKGLNEKDLVILSGGHTIGMGHCPLMSNRLYNFTGRGDSDPSLDSEYATSLRKKCKPTDTTTALEMD
PGSFKTFDVSYFKLVAKRRGLFQSDAALLDNSKTRAHVLEQARGSTFFHDFGVSMVKMGRTGVLTGRAGEIRKMCRVPN*

DNA
ATGGCTGCATGTAAGCGATTAGTTGTCGCTTGCTTTTTCTTAGTGTTGTTGCTAGCAGAAGCCAATGCGCAAGGCTTGAA
AGTAGGCTTCTACAGAAAAACATGCCCACATGCCGAGGGTATTGTTAAAAAGGTCGTGTTTGCTGCCATGAAGAAAGCGC
CTACCCTTGGTGCTCCTTTGCTTAGAATGTTCTTCCACGACTGCTTCGTTCGGGGATGTGATGGATCAGTCTTGTTAGAT
TCATCTAACAATCAAGCCGAGAAGAATGCCGTTCCTAACCTAAGCCTTCGAGGGTTCGACATCTTAGACGATTCTAAGGC
AGCTCTAGAAAAAGTGTGCCCTGGCATAGTTTCTTGCTCTGATATCTTAGCCCTTGTCGCTAGGGACGCAATGGTTGCAC
TTGAAGGACCAACGTGGGAAGTTGAAACGGGAAGAAGAGATGGTAGGGTTTCTAATATCAATGAGGTCAACTTGCCATCA
CCTTTTGATAACATCACCAAACTTATCACCGATTTTCGCACAAAGGGACTCAACGAGAAAGATCTAGTCATTCTTTCAGG
TGGCCACACTATTGGGATGGGTCATTGCCCTCTAATGTCAAACCGTCTTTACAACTTCACCGGAAGAGGAGACAGCGATC
CGAGTTTGGACTCGGAGTACGCCACTAGCCTCAGGAAGAAATGCAAGCCGACCGACACCACGACGGCTCTAGAGATGGAT
CCAGGAAGTTTCAAGACATTCGACGTGAGCTACTTCAAGCTAGTGGCAAAGAGAAGAGGGCTTTTCCAGTCGGATGCTGC
TCTATTGGACAACTCAAAGACTAGGGCTCATGTCTTGGAGCAGGCACGTGGGTCAACCTTCTTTCATGACTTTGGTGTCT
CAATGGTGAAAATGGGTCGGACCGGAGTTCTTACTGGTCGGGCTGGGGAGATCCGTAAGATGTGTCGTGTTCCTAATTAA