Details for Kale Locus Bo5g156350

Position : C5 ( 5`- 46828764 .. 46830223 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156350

Protein [Map View]
MNSRGHPEPDSESPPTIPSSPRTPRMKVSSKLNRWSMGRALRSGAVKIDRQTLRTDNNDNPCRQVTSEEADRKTSAIEDG
FRDDVAGKSIYMVSDGTGWTAEHSVNAALGQFEDPLVNRGFPVNTHLFSWVEDEEKLIEIIKQAAKQKAMCFYTLANPSM
SKSAKEACDLLGVLSVDILGPIIQGIASHLGVSPSGLTRGAAGRVKTLNDAYFKRIEAIEFTIKQDDGTLPENLGKADII
LVGVSRTGKTPLSTYIAQKGYKVANVPFVMGVEPPKTLFDVEPRKVFGLKIQLVVLQAIRRTRAKTLGVDTVGENRYSGF
DLVRKELDFAAKIYAKNPGWAVIDVTNKAIEETAAVILRLYHDGSDSSTSVPCISKRF*

DNA
ATGAATTCACGAGGCCATCCCGAACCTGATTCCGAGTCTCCTCCGACTATACCGTCGAGTCCCCGGACACCGAGGATGAA
GGTTAGTTCCAAACTGAATCGATGGTCCATGGGCCGAGCTTTACGTTCCGGTGCTGTTAAGATTGACCGTCAGACTCTTC
GTACCGATAACAACGACAATCCTTGCCGTCAAGTGACGTCGGAAGAGGCTGATAGAAAGACGTCTGCTATCGAGGACGGT
TTTAGAGATGACGTGGCGGGAAAGTCAATATATATGGTTTCAGACGGGACAGGGTGGACGGCAGAGCACTCCGTTAACGC
CGCTTTGGGCCAATTCGAAGATCCATTGGTTAATCGTGGTTTTCCCGTTAACACCCATCTCTTCTCTTGGGTTGAGGATG
AGGAGAAGCTAATAGAGATTATCAAGCAGGCGGCGAAGCAAAAGGCAATGTGTTTCTACACTTTAGCCAATCCTTCTATG
TCCAAATCCGCTAAAGAAGCTTGTGATCTATTAGGCGTGCTCTCTGTCGACATCTTAGGACCAATTATCCAAGGCATTGC
GTCTCACTTGGGTGTTTCTCCGTCGGGTCTTACCCGCGGAGCTGCAGGTAGGGTCAAGACTCTCAACGATGCATACTTCA
AAAGAATCGAAGCCATTGAGTTTACCATTAAGCAAGATGACGGGACTTTACCTGAGAACTTAGGCAAGGCTGATATCATT
CTTGTCGGTGTTTCACGGACGGGAAAGACGCCGCTGTCTACTTATATTGCTCAGAAAGGGTATAAAGTCGCAAATGTACC
GTTTGTGATGGGCGTAGAACCGCCCAAGACGCTTTTTGATGTTGAACCGAGAAAAGTTTTTGGGTTGAAGATTCAACTTG
TGGTACTGCAAGCCATCAGGAGAACAAGAGCTAAAACGTTAGGTGTGGATACGGTAGGAGAGAACAGATACTCAGGCTTC
GATCTTGTTCGGAAAGAACTTGATTTCGCGGCAAAGATCTATGCGAAAAACCCTGGATGGGCGGTCATAGATGTGACGAA
TAAAGCGATAGAAGAAACAGCAGCTGTGATTCTGCGGCTTTATCATGACGGTAGCGACAGTAGTACTTCTGTACCTTGTA
TCTCAAAACGCTTCTAA