Details for Kale Locus Bo5g156340

Position : C5 ( 5`- 46825921 .. 46827890 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156340

Protein [Map View]
MAFPQHGFTFQQLHEDISPDQLPSCLPPHPFNGGGNYMMNRSMSLTNVRDDPHQSVDEENLSDDGSHMMLGEKKRRLPLE
QVKVLEKSFELGNKLDPERKIQLAKALGMQPRQIAIWFQNRRARWKTRQLERDYDSLKKQFDSLKSDNDSLLAHNKKLLV
EVMSLKNKDYNEASIIKREAEASWSNNGSTENSSDINLEIPRETTTTHVNTIKNLFPSSIPSSTHHQDHHGDHHHQNNEM
VQEESFCNMFNGIDETTSAGYWGWSDPNYNHHHQFN*

DNA
ATGGCATTTCCTCAGCATGGTTTTACGTTCCAACAACTTCATGAAGACATTAGCCCTGATCAGCTCCCTTCTTGTCTTCC
TCCTCATCCCTTCAATGGAGGAGGAAACTACATGATGAACAGATCTATGTCGTTAACGAACGTGCGAGATGATCCTCATC
AATCTGTTGATGAGGAGAATTTATCAGACGATGGGTCGCATATGATGCTTGGAGAGAAGAAGAGGAGGCTGCCATTAGAG
CAAGTTAAGGTATTAGAGAAGAGCTTCGAGCTTGGGAACAAGCTGGATCCAGAGAGGAAGATACAACTAGCTAAAGCACT
GGGGATGCAACCTAGGCAGATAGCGATCTGGTTTCAAAACAGGAGAGCTAGGTGGAAGACTAGACAGCTCGAAAGAGACT
ATGATTCACTCAAGAAGCAGTTTGATTCTCTTAAGTCTGACAATGATTCTCTTCTTGCCCACAACAAGAAACTCCTTGTT
GAGGTAATGTCTTTAAAGAACAAAGATTATAATGAAGCAAGCATAATAAAGAGGGAAGCAGAAGCTTCATGGAGCAACAA
TGGAAGCACAGAAAATAGCTCAGACATAAATCTGGAGATTCCTAGAGAGACCACCACAACACATGTGAACACGATCAAAA
ACCTTTTCCCTTCATCGATTCCGTCATCTACACATCATCAAGATCATCATGGTGATCATCATCATCAGAATAATGAAATG
GTTCAAGAAGAGAGCTTCTGTAACATGTTTAATGGCATTGATGAAACGACTTCGGCTGGTTACTGGGGATGGTCTGACCC
AAACTACAACCACCACCACCAATTCAATTGA