Details for Kale Locus Bo5g156310

Position : C5 ( 5`- 46818950 .. 46819432 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g156310

Protein [Map View]
MATKSLILYGLVVTLVIALICNIEEAAARDVKLVKLRDVKPETLTTLKGEEEKELLNDKLTKEIENAKKLLGELKTLKKE
SKDDMKEELSSLMKSETLLNEMSDTLKNGTCNANKATIFVEKESFFYRAWKENAYHSVVPEKEKEFMSNIKRIIKLLKKT
*

DNA
ATGGCAACGAAGTCTTTAATACTGTATGGTCTTGTCGTGACCCTAGTCATCGCATTGATATGCAACATCGAAGAGGCTGC
AGCGAGAGACGTAAAGCTAGTGAAACTCCGCGATGTAAAGCCCGAAACGTTGACAACATTAAAAGGAGAAGAAGAAAAAG
AACTCTTGAACGATAAACTTACAAAAGAGATTGAGAATGCAAAGAAATTGCTGGGAGAGTTGAAAACGTTGAAGAAGGAA
TCAAAAGATGATATGAAAGAGGAGTTGAGTTCTTTGATGAAATCTGAAACGCTACTTAACGAAATGTCGGATACACTCAA
GAACGGAACGTGCAATGCAAACAAAGCTACGATATTTGTAGAGAAAGAATCGTTTTTCTACAGAGCATGGAAGGAGAATG
CATATCATTCGGTGGTTCCAGAGAAGGAGAAAGAGTTTATGTCTAACATAAAACGCATTATTAAGCTGTTGAAGAAAACT
TAG