Details for Kale Locus Bo5g155290

Position : C5 ( 5`- 46783629 .. 46784728 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155290

Protein [Map View]
MGNLLCCVLVKQSDVAIKERFGKFQKVLNPGLQFVPWVIGDYVAGHLTLRLQQLDVQCETKTKDNVFVTVVASIQYRVLV
DKASDAFYRLSNPTSQIKAYVFDVIRACVPKLNLDDVFEQKNEIAKSVEEELDKAMTAYGYEILQTLIIDIEPDQQVKRA
MNEINAAARMRVAANEKAEAEKIIQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSVLGFAGNVPGTSAKDVLDMVMMT
QYFDTMRDIGASSKSSSVFIPHGPGAVADVAAQIRNGLLQAHQTNA*

DNA
ATGGGGAACCTTTTGTGCTGCGTGCTGGTGAAGCAATCAGATGTTGCGATCAAGGAGAGATTTGGCAAATTTCAAAAAGT
TCTTAATCCAGGTCTCCAGTTTGTGCCCTGGGTCATAGGTGATTATGTCGCCGGTCATCTCACCCTCCGTCTCCAGCAAC
TCGATGTTCAATGCGAAACCAAAACCAAGGACAATGTGTTTGTGACAGTGGTTGCATCCATTCAATACAGAGTCTTGGTT
GACAAGGCAAGTGATGCTTTCTACAGACTTAGCAATCCTACTTCCCAAATCAAAGCCTATGTCTTCGACGTGATCAGAGC
ATGTGTACCAAAGCTGAACTTGGACGATGTCTTCGAGCAGAAGAATGAGATCGCAAAATCAGTGGAAGAAGAGCTAGACA
AAGCCATGACTGCTTATGGTTATGAGATCCTTCAAACCCTTATCATCGACATCGAGCCTGACCAACAGGTTAAACGCGCC
ATGAACGAAATCAACGCCGCGGCGAGGATGAGAGTGGCGGCGAACGAGAAAGCAGAGGCGGAGAAAATCATTCAGATAAA
GAGAGCAGAAGGAGAAGCTGAGTCCAAGTACCTATCTGGTCTCGGTATCGCTCGTCAGAGACAAGCTATCGTTGACGGTC
TCAGAGACAGTGTTCTCGGCTTCGCGGGAAACGTGCCTGGGACGTCAGCGAAGGATGTGTTGGACATGGTGATGATGACT
CAGTACTTTGACACTATGAGAGATATCGGAGCTTCTTCCAAATCTTCGTCGGTGTTTATCCCTCACGGTCCCGGCGCCGT
CGCAGACGTGGCGGCACAAATTCGAAATGGATTATTGCAGGCCCACCAGACCAATGCCTAA