Details for Kale Locus Bo5g155280

Position : C5 ( 5`- 46770217 .. 46772374 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155280

Protein [Map View]
MSLDSVKVMEKSNKSNESEKKKKRKKQKKNNVRNSEGEGEEANGCWVKFRVMVCGLPSTTDVDNSSSPTLSTTTLGSKSV
ATVKSNEQPAGPVSSSTTATSNAESSLSTPMISEELKIYSHLKQFSFLDLKLATRNFRPESLLGEGGFGCVFKGWVEENG
TAPVKPGTGLTVAVKTLNLDGLQGHKEWLAEINYLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLP
WSIRMRIALGAAKGLSFLHEEALKPVIYRDFKTSNILLDSDYNAKLSDFGLAKDAPDEGKTHVSTRVMGTYGYAAPEYVM
TGHLTSMSDVYSFGVVLLEMLTGRRSMDKNRPSGEQNLVEWARPHLLDRRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCL
SRDSKIRPKMSEVVEVLKPLPLLKDMASSSYYFQTMQAERLKAGSGSGRGLGLRNGQPVLRTLSSPHGQAGSSPYRHQIP
SPKPKGATT*

DNA
ATGAGTTTAGATTCCGTCAAAGTAATGGAGAAATCGAACAAATCCAACGAGAGCGAGAAGAAGAAGAAGAGGAAGAAGCA
GAAGAAGAACAATGTCAGGAACAGCGAAGGCGAAGGCGAAGAAGCAAATGGGTGCTGGGTCAAATTTAGGGTTATGGTTT
GTGGCCTACCTTCAACAACAGACGTTGATAATAGCTCATCTCCCACTCTCTCTACAACCACTCTGGGGAGTAAGTCGGTA
GCAACTGTGAAATCAAATGAGCAACCAGCTGGCCCTGTTTCTTCTTCTACAACCGCAACTAGCAATGCTGAAAGCTCTTT
GTCCACTCCTATGATCAGTGAAGAGCTTAAGATCTATTCCCACCTCAAGCAGTTTTCTTTCCTTGATCTCAAGTTAGCTA
CTAGAAATTTCAGACCCGAGAGTCTCCTCGGGGAAGGCGGGTTTGGTTGTGTCTTCAAAGGATGGGTCGAGGAGAACGGC
ACTGCTCCTGTTAAGCCTGGCACTGGCCTTACTGTGGCAGTTAAAACCTTAAATCTTGATGGTCTTCAGGGTCATAAAGA
GTGGCTTGCTGAGATTAACTATTTGGGTAATCTTCTGCATCCGAATCTTGTTAAACTGGTGGGTTATTGTATCGAAGATG
ACCAAAGGCTGCTGGTTTATGAGTTTATGCCTCGAGGAAGTTTGGAGAATCACCTCTTCAGAAGGTCGTTGCCTCTTCCA
TGGTCGATTCGGATGAGGATTGCATTAGGTGCTGCCAAGGGTCTCAGTTTCCTCCACGAAGAAGCTCTTAAGCCTGTCAT
ATATCGAGATTTCAAAACCTCCAACATTTTACTAGATTCAGACTACAATGCGAAACTATCAGATTTTGGGCTTGCTAAAG
ATGCTCCTGATGAAGGCAAAACGCATGTCTCTACTCGAGTCATGGGCACTTATGGTTACGCTGCTCCTGAGTATGTTATG
ACTGGTCACTTGACATCGATGAGCGATGTGTATAGTTTCGGTGTGGTTCTACTCGAAATGCTGACTGGTAGAAGATCCAT
GGACAAAAACCGACCAAGCGGTGAGCAAAACCTCGTTGAATGGGCTAGACCGCATCTCCTCGACAGAAGAAGATTCTACC
GGCTACTTGATCCGAGGCTGGAGGGCCATTTCTCCATCAAAGGAGCTCAGAAAGTGACTCAGCTTGCGGCCCAATGCCTT
AGCCGTGACTCCAAGATCAGACCCAAAATGAGTGAAGTGGTTGAAGTCCTTAAGCCACTCCCGCTTCTCAAAGACATGGC
TAGCTCTTCCTACTACTTCCAGACAATGCAAGCCGAGCGGTTGAAAGCTGGGTCTGGGTCTGGTCGTGGGTTGGGGTTGA
GAAACGGACAACCTGTGCTTAGGACACTGTCTAGTCCTCATGGCCAAGCTGGTTCTTCACCTTATCGTCATCAGATTCCG
TCTCCTAAGCCCAAAGGTGCAACTACTTAG